Xenorhabdus bovienii Rhs C-terminal toxin TreX complex with TriX immunity protein. Determined by X-ray diffraction at 1.28 Å resolution. Released 4 Dec 2024.
Explore 8S2M in 3D Show helices and sheets RCSB PDB PDBe
8S2M contains 14 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-13 | 10 | 1 |
| β-strand | 16-27 | 12 | 1 |
| β-strand | 31-38 | 8 | 1 |
| β-strand | 41-48 | 8 | 1 |
| α-helix | 51-61 | 11 | |
| β-strand | 65-67 | 3 | 1 |
| β-strand | 69 | 1 | 2 |
| α-helix | 70-72 | 3 | |
| β-strand | 76-77 | 2 | 3 |
| α-helix | 80-86 | 7 | |
| β-strand | 90-93 | 4 | 3 |
| β-strand | 95 | 1 | 4 |
| β-strand | 98 | 1 | 4 |
| α-helix | 102-104 | 3 | |
| β-strand | 105-107 | 3 | 3 |
| β-strand | 111 | 1 | 2 |
| α-helix | 120-132 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-17 | 7 | 5 |
| α-helix | 21-27 | 7 | |
| β-strand | 29 | 1 | 6 |
| β-strand | 35 | 1 | 7 |
| α-helix | 38-43 | 6 | |
| β-strand | 46 | 1 | 8 |
| β-strand | 49 | 1 | 8 |
| β-strand | 50 | 1 | 7 |
| β-strand | 52-56 | 5 | 5 |
| α-helix | 59-62 | 4 | |
| α-helix | 63-66 | 4 | |
| β-strand | 74-81 | 8 | 5 |
| β-strand | 85-86 | 2 | 5 |
| α-helix | 87-91 | 5 | |
| α-helix | 92-94 | 3 | |
| α-helix | 98-100 | 3 | |
| β-strand | 102-106 | 5 | 5 |
| β-strand | 109 | 1 | 6 |
| α-helix | 111-113 | 3 | |
| β-strand | 114-120 | 7 | 5 |
| α-helix | 125 | 1 | |
| β-strand | 126-132 | 7 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunity Protein TriX | A | protein | 142 | Xenorhabdus bovienii SS-2004 | D3UXR2 (AlphaFold model) |
| Complete genome segment 11/17 | B | protein | 140 | Xenorhabdus bovienii SS-2004 | D3UXR3 |
>8S2M_1 Immunity Protein TriX (chains A) MTDVDKRKIKIILNGEMEEAELHMITSPNRHCCLKIFHNNNQLAESNDTDYFSCFADLRN QLKNIIFLCKGAKINVYPSAMSRDMSDGIVAYETTLGQPGLPENQVHIFDFEDKYVDITP EEQRKFHSQWFESLVDHHHHHH
>8S2M_2 Complete genome segment 11/17 (chains B) MAGGIGNKGDYIITYRGDTRSFTEIFDKGFETLGPSKDLYKHALDNRAPPSDFVSTTIDP TKTISFATKYGQKSGYMYTMKTNHGIDVNKALGARSPFAAEAEIAMPGGVRAEDILGARA VNADGEMWDYTILNPKRYGK
Thioredoxin 1 moonlights as a chaperone for an interbacterial ADP-ribosyltransferase toxin. Dumont, B., Terradot, L., Cascales, E. et al. Nat Commun (2024) 15:10388-10388. DOI 10.1038/s41467-024-54892-w · PubMed
Other PDB entries of the same protein (UniProt D3UXR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8S2M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.