8S2N: Immunity Protein TriX

Name: PDB 8S2N: Xenorhabdus bovienii Rhs toxin TreTu complex with TrxA and TriTu immunity protein
Published: 2024-12-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Xenorhabdus bovienii Rhs toxin TreTu complex with TrxA and TriTu immunity protein. Determined by X-ray diffraction at 2.11 Å resolution. Released 4 Dec 2024.

Method: X-ray diffraction
Resolution: 2.11 Å
Organisms: Xenorhabdus bovienii SS-2004, Escherichia coli str. K-12 substr. MG1655
Chains: 3
Atoms: 3,019
Mol. weight: 44.27 kDa
Released: 4 Dec 2024

Explore 8S2N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8S2N contains 22 α-helices and 32 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-13	11	1
β-strand	16-27	12	1
β-strand	31-38	8	1
β-strand	41-48	8	1
α-helix	51-61	11
β-strand	65-67	3	1
β-strand	69	1	2
α-helix	70-72	3
β-strand	76-77	2	3
α-helix	80-86	7
β-strand	90-93	4	3
β-strand	95	1	4
β-strand	98	1	4
α-helix	102-104	3
β-strand	105-107	3	3
β-strand	111	1	2
α-helix	120-133	14

Chain B: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	5
α-helix	22-28	7
β-strand	30	1	6
β-strand	36	1	7
α-helix	39-45	7
β-strand	47	1	8
β-strand	50	1	8
β-strand	51	1	7
β-strand	53-57	5	5
α-helix	60-63	4
α-helix	64-67	4
β-strand	75-82	8	5
β-strand	86-87	2	5
α-helix	88-92	5
α-helix	93-95	3
α-helix	99-101	3
β-strand	103-107	5	5
β-strand	110	1	6
α-helix	112-114	3
β-strand	115-121	7	5
α-helix	126	1
β-strand	127	1	5
α-helix	128	1
β-strand	131-133	3	5
α-helix	134	1
α-helix	135-138	4

Chain C: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	9
α-helix	15	1
α-helix	16-20	5
β-strand	26-31	6	9
α-helix	36-51	16
β-strand	57-62	6	9
α-helix	69-72	4
β-strand	77-78	2	5
β-strand	80-85	6	9
β-strand	88-94	7	9
α-helix	99-107	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunity Protein TriX	A	protein	142	Xenorhabdus bovienii SS-2004	D3UXR2 (AlphaFold model)
Complete genome segment 11/17	B	protein	140	Xenorhabdus bovienii SS-2004	D3UXR3
Thioredoxin 1	C	protein	111	Escherichia coli str. K-12 substr. MG1655	P0AA25 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8S2N_1 Immunity Protein TriX (chains A)
MTDVDKRKIKIILNGEMEEAELHMITSPNRHCCLKIFHNNNQLAESNDTDYFSCFADLRN
QLKNIIFLCKGAKINVYPSAMSRDMSDGIVAYETTLGQPGLPENQVHIFDFEDKYVDITP
EEQRKFHSQWFESLVDHHHHHH

Sequence of entity 2 (B), FASTA

>8S2N_2 Complete genome segment 11/17 (chains B)
MAGGIGNKGDYIITYRGDTRSFTEIFDKGFETLGPSKDLYKHALDNRAPPSDFVSTTIDP
TKTISFATKYGQKSGYMYTMKTNHGIDVNKALGARSPFAAEAEIAMPGGVRAEDILGARA
VNADGEMWDYTILNPKRYGK

Sequence of entity 3 (C), FASTA

>8S2N_3 Thioredoxin 1 (chains C)
GASSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAK
LNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

Primary citation

Thioredoxin 1 moonlights as a chaperone for an interbacterial ADP-ribosyltransferase toxin. Dumont, B., Terradot, L., Cascales, E. et al. Nat Commun (2024) 15:10388-10388. DOI 10.1038/s41467-024-54892-w · PubMed

Other PDB entries of the same protein (UniProt D3UXR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8S2M 1.28 Å, Xenorhabdus bovienii Rhs C-terminal toxin TreX complex with TriX immunity protein
9GCO 2.0 Å, Xenorhabdus bovienii Thioredoxin complex with Rhs toxin TreX and immunity protein TriX

Browse structure collections

About this viewer

MolViewer shows 8S2N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.