Crystal structure of JAK1 JH1 domain in complex with an inhibitor. Determined by X-ray diffraction at 1.75 Å resolution. Released 6 Nov 2024.
Explore 8S85 in 3D Show helices and sheets RCSB PDB PDBe
8S85 contains 41 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 854-856 | 3 | |
| α-helix | 858-862 | 5 | |
| β-strand | 869 | 1 | 1 |
| α-helix | 872-874 | 3 | |
| β-strand | 875-884 | 10 | 1 |
| β-strand | 887-894 | 8 | 1 |
| β-strand | 903-910 | 8 | 1 |
| α-helix | 918-930 | 13 | |
| β-strand | 937 | 1 | 2 |
| α-helix | 938-939 | 2 | |
| β-strand | 940-944 | 5 | 1 |
| β-strand | 953-957 | 5 | 1 |
| β-strand | 963 | 1 | 2 |
| α-helix | 964-970 | 7 | |
| α-helix | 972-974 | 3 | |
| α-helix | 977-996 | 20 | |
| β-strand | 999-1000 | 2 | 3 |
| α-helix | 1006-1008 | 3 | |
| β-strand | 1009-1013 | 5 | 2 |
| β-strand | 1016-1019 | 4 | 2 |
| β-strand | 1026-1027 | 2 | 3 |
| α-helix | 1028-1029 | 2 | |
| β-strand | 1035-1036 | 2 | 4 |
| α-helix | 1045-1047 | 3 | |
| α-helix | 1050-1055 | 6 | |
| β-strand | 1057-1058 | 2 | 4 |
| α-helix | 1060-1075 | 16 | |
| α-helix | 1080-1082 | 3 | |
| α-helix | 1084-1092 | 9 | |
| α-helix | 1097-1099 | 3 | |
| α-helix | 1100-1109 | 10 | |
| α-helix | 1114-1117 | 4 | |
| α-helix | 1122-1130 | 9 | |
| α-helix | 1136-1138 | 3 | |
| α-helix | 1140-1141 | 2 | |
| α-helix | 1142-1153 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 869 | 1 | 5 |
| α-helix | 872-874 | 3 | |
| β-strand | 875-884 | 10 | 5 |
| β-strand | 887-894 | 8 | 5 |
| β-strand | 903-910 | 8 | 5 |
| α-helix | 919-930 | 12 | |
| β-strand | 937 | 1 | 6 |
| α-helix | 938-939 | 2 | |
| β-strand | 940-944 | 5 | 5 |
| β-strand | 953-957 | 5 | 5 |
| β-strand | 963 | 1 | 6 |
| α-helix | 964-971 | 8 | |
| α-helix | 977-996 | 20 | |
| β-strand | 999-1000 | 2 | 7 |
| α-helix | 1006-1008 | 3 | |
| β-strand | 1009-1013 | 5 | 6 |
| β-strand | 1016-1019 | 4 | 6 |
| β-strand | 1026-1027 | 2 | 7 |
| α-helix | 1028-1029 | 2 | |
| β-strand | 1034-1036 | 3 | 8 |
| α-helix | 1045-1047 | 3 | |
| α-helix | 1050-1055 | 6 | |
| β-strand | 1057-1059 | 3 | 8 |
| α-helix | 1060-1075 | 16 | |
| α-helix | 1080-1082 | 3 | |
| α-helix | 1084-1092 | 9 | |
| α-helix | 1097-1099 | 3 | |
| α-helix | 1100-1109 | 10 | |
| α-helix | 1114-1117 | 4 | |
| α-helix | 1122-1130 | 9 | |
| α-helix | 1136-1138 | 3 | |
| α-helix | 1140-1141 | 2 | |
| α-helix | 1142-1152 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein kinase JAK1 | A, B | protein | 302 | Homo sapiens | P23458 (AlphaFold model) |
>8S85_1 Tyrosine-protein kinase JAK1 (chains A, B) GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKP ESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNK NKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDK EYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMI GPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEAL LK
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1H5R | ~{N}-(2-ethylphenyl)-~{N},1-dimethyl-imidazo[4,5-c]pyridin-6-amine | C16 H18 N4 | 2 |
Water and common crystallization additives (NA) are not listed.
Design of a potent and selective dual JAK1/TYK2 inhibitor. Mammoliti, O., Menet, C., Cottereaux, C. et al. Bioorg Med Chem (2024) 114:117932-117932. DOI 10.1016/j.bmc.2024.117932 · PubMed
Other PDB entries of the same protein (UniProt P23458 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8S85 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.