8SII: CBX7 with compound UNC4976

Crystal Structure of CBX7 with compound UNC4976. Determined by X-ray diffraction at 1.37 Å resolution. Released 4 Sept 2024.

Method: X-ray diffraction
Resolution: 1.37 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 1,286
Mol. weight: 15.79 kDa
Ligands: CA
Released: 4 Sept 2024

Explore 8SII in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SII contains 7 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	9-11	3	1
β-strand	13-22	10	2
β-strand	25-32	8	2
α-helix	37-39	3
β-strand	41-44	4	2
α-helix	45-47	3
β-strand	48	1	1
α-helix	51-61	11

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	9-11	3	3
β-strand	13-22	10	4
β-strand	25-32	8	4
α-helix	37-39	3
β-strand	41-44	4	4
α-helix	45-47	3
β-strand	48	1	3
α-helix	51-61	11

Chains F and G: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-5	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 7	A, B	protein	56	Homo sapiens	O95931 (AlphaFold model)
UNC4976	F, G	protein	6	synthetic construct

Sequence of entity 1 (A, B), FASTA

>8SII_1 Chromobox protein homolog 7 (chains A, B)
GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE

Sequence of entity 2 (F, G), FASTA

>8SII_2 UNC4976 (chains F, G)
XFALXX

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (SO4, CL) are not listed.

Primary citation

Crystal Structure of CBX7 with compound UNC4976. Song, X., Dong, A., Huang, R. et al. To be published.

Other PDB entries of the same protein (UniProt O95931 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4MN3 1.54 Å, Chromodomain antagonists that target the polycomb-group methyllysine reader protein…
5EPJ 1.6 Å, Crystal Structure of chromodomain of CBX7 in complex with inhibitor UNC3866
6V2R 1.6 Å, Crystal Structure of chromodomain of CBX7 mutant V13A in complex with inhibitor UNC3866
3GS2 1.7 Å, Ring1B C-terminal domain/Cbx7 Cbox Complex
9V9P 3.4 Å, Cryo-EM structure of the cPRC1-di-nucleosome (CBX7) complex
2K1B Solution NMR structure of the chromo domain of the chromobox protein homolog 7
2L12 Solution NMR structure of the chromobox protein 7 with H3K9me3
2L1B Solution NMR structure of the chromobox protein Cbx7 with H3K27me3

Browse structure collections

About this viewer

MolViewer shows 8SII directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.