ZnFs 3-11 of CCCTC-binding factor (CTCF) Complexed with 35mer DNA 35-4. Determined by X-ray diffraction at 3.12 Å resolution. Released 2 Aug 2023.
Explore 8SSQ in 3D Show helices and sheets RCSB PDB PDBe
8SSQ contains 23 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 322-323 | 2 | 1 |
| β-strand | 330-331 | 2 | 1 |
| α-helix | 334-341 | 8 | |
| α-helix | 342-346 | 5 | |
| β-strand | 351-352 | 2 | 2 |
| β-strand | 359-360 | 2 | 2 |
| α-helix | 363-374 | 12 | |
| β-strand | 379-380 | 2 | 3 |
| β-strand | 387-388 | 2 | 3 |
| α-helix | 391-397 | 7 | |
| α-helix | 399-402 | 4 | |
| β-strand | 407-408 | 2 | 4 |
| β-strand | 415-416 | 2 | 4 |
| α-helix | 419-429 | 11 | |
| β-strand | 437-438 | 2 | 5 |
| α-helix | 439 | 1 | |
| β-strand | 445-446 | 2 | 5 |
| α-helix | 449-458 | 10 | |
| β-strand | 462-468 | 7 | 6 |
| β-strand | 475-478 | 4 | 6 |
| α-helix | 479-486 | 8 | |
| α-helix | 487-489 | 3 | |
| β-strand | 495-496 | 2 | 7 |
| β-strand | 503-504 | 2 | 7 |
| α-helix | 507-518 | 12 | |
| β-strand | 523-524 | 2 | 8 |
| β-strand | 531-532 | 2 | 8 |
| α-helix | 535-545 | 11 | |
| β-strand | 555-556 | 2 | 9 |
| β-strand | 563-564 | 2 | 9 |
| α-helix | 567-576 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 351-352 | 2 | 10 |
| β-strand | 359-360 | 2 | 10 |
| α-helix | 363-374 | 12 | |
| β-strand | 379-380 | 2 | 11 |
| β-strand | 387-388 | 2 | 11 |
| α-helix | 391-402 | 12 | |
| β-strand | 407-408 | 2 | 12 |
| β-strand | 415-416 | 2 | 12 |
| α-helix | 419-429 | 11 | |
| α-helix | 436 | 1 | |
| β-strand | 437-438 | 2 | 13 |
| α-helix | 439 | 1 | |
| β-strand | 445-446 | 2 | 13 |
| α-helix | 450-459 | 10 | |
| β-strand | 467-468 | 2 | 14 |
| β-strand | 475-476 | 2 | 14 |
| α-helix | 479-489 | 11 | |
| β-strand | 495-496 | 2 | 15 |
| β-strand | 503-504 | 2 | 15 |
| α-helix | 507-516 | 10 | |
| β-strand | 523-524 | 2 | 16 |
| β-strand | 531-532 | 2 | 16 |
| α-helix | 535-545 | 11 | |
| β-strand | 555-556 | 2 | 17 |
| β-strand | 563-564 | 2 | 17 |
| α-helix | 567-575 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcriptional repressor CTCF | A, D | protein | 288 | Homo sapiens | P49711 (AlphaFold model) |
| DNA (35-MER) Strand I | B, E | DNA | 35 | Homo sapiens | |
| DNA (35-MER) Strand 2 | C, F | DNA | 35 | Homo sapiens |
>8SSQ_1 Transcriptional repressor CTCF (chains A, D) TRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRSHTGERP FQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFH CPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKCD QCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCS KCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKRKMRSKK
>8SSQ_2 DNA (35-MER) Strand I (chains B, E) TTAGCGCCCCCTGCTGGTTAAATGTGGTACTGCAC
>8SSQ_3 DNA (35-MER) Strand 2 (chains C, F) GTGCAGTACCACATTTAACCAGCAGGGGGCGCTAA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 17 |
Water and common crystallization additives (NA) are not listed.
Structures of CTCF-DNA complexes including all 11 zinc fingers. Yang, J., Horton, J.R., Liu, B. et al. Nucleic Acids Res (2023) 51:8447-8462. DOI 10.1093/nar/gkad594 · PubMed
Other PDB entries of the same protein (UniProt P49711 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8SSQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.