8T0M: Proteasome subunit alpha type-1

Proteasome 20S core particle from Pre1-1 Pre4-1 Double mutant. Determined by electron microscopy at 2.4 Å resolution. Released 6 Sept 2023.

Method: Electron microscopy
Resolution: 2.4 Å
Organism: Saccharomyces cerevisiae S288C
Chains: 28
Atoms: 47,538
Mol. weight: 763.42 kDa
Released: 6 Sept 2023

Explore 8T0M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8T0M contains 245 α-helices and 394 β-strands across 28 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains a and M: 7 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	31-36	6	5
β-strand	41-46	6	5
β-strand	49-51	3	6
β-strand	54-57	4	6
β-strand	64-65	2	7
β-strand	71-76	6	7
α-helix	78-98	21
α-helix	102-105	4
α-helix	106-118	13
β-strand	127-134	8	7
β-strand	140-145	6	7
β-strand	151-154	4	7
β-strand	156-160	5	5
α-helix	161-165	5
α-helix	167-173	7
β-strand	180	1	8
β-strand	189	1	8
α-helix	190-192	3
α-helix	197-214	18
β-strand	215	1	39
β-strand	222-227	6	5
β-strand	232-237	6	5

Chain A: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
α-helix	26-34	9
β-strand	42-46	5	1
β-strand	51-56	6	1
β-strand	64	1	2
α-helix	66-68	3
β-strand	72-74	3	3
β-strand	80-84	5	3
α-helix	87-108	22
α-helix	111-113	3
α-helix	114-130	17
β-strand	131	1	4
α-helix	135-137	3
β-strand	140-147	8	3
β-strand	151-157	7	3
β-strand	163-166	4	3
β-strand	168-171	4	1
α-helix	175-185	11
α-helix	199-214	16
β-strand	223-228	6	1
β-strand	233-235	3	1
α-helix	238-249	12

Chain b: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	15
β-strand	45-50	6	16
β-strand	53-59	7	16
β-strand	62-64	3	15
β-strand	67-70	4	15
β-strand	76-78	3	15
β-strand	83-90	8	15
α-helix	91-109	19
α-helix	121-122	2
α-helix	123-139	17
β-strand	146-153	8	15
β-strand	159-165	7	15
β-strand	170-172	3	15
β-strand	175-177	3	16
α-helix	181-190	10
α-helix	196-198	3
α-helix	204-221	18
β-strand	222	1	37
β-strand	228-235	8	16
β-strand	239-247	9	16

Chains B and P: 14 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	9
β-strand	12	1	10
β-strand	18	1	10
α-helix	19-29	11
α-helix	32-33	2
β-strand	34-38	5	11
β-strand	43-48	6	11
β-strand	56-57	2	3
α-helix	58-60	3
β-strand	65-68	4	12
β-strand	71-77	7	12
α-helix	79-92	14
α-helix	93-98	6
α-helix	99-101	3
α-helix	104-106	3
α-helix	107-123	17
β-strand	125	1	9
β-strand	127	1	4
α-helix	128-130	3
β-strand	132-140	9	12
β-strand	144-150	7	12
β-strand	156-158	3	12
β-strand	159	1	13
β-strand	161-164	4	11
α-helix	168-178	11
α-helix	185-199	15
β-strand	209-214	6	11
α-helix	219-221	3
β-strand	224-225	2	14
β-strand	235-237	3	11
α-helix	238-239	2
α-helix	240-248	9

Chain C: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	13	1	17
β-strand	19	1	17
α-helix	20-29	10
α-helix	33-34	2
β-strand	35-40	6	18
β-strand	43-49	7	18
β-strand	57	1	13
β-strand	66-68	3	19
β-strand	73-79	7	19
α-helix	81-102	22
α-helix	105-107	3
α-helix	108-124	17
β-strand	125	1	20
α-helix	128-131	4
β-strand	133-141	9	19
β-strand	145-151	7	19
β-strand	157-160	4	19
β-strand	162-165	4	18
α-helix	169-179	11
α-helix	186-198	13
α-helix	208-210	3
β-strand	211-217	7	18
β-strand	226-229	4	18
α-helix	230-231	2
α-helix	232-242	11

Chain D: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	21
β-strand	17	1	21
α-helix	18-28	11
β-strand	32-37	6	22
β-strand	42-46	5	22
β-strand	55	1	19
α-helix	61-62	2
β-strand	65-66	2	23
β-strand	71-77	7	23
α-helix	79-100	22
α-helix	103-105	3
α-helix	106-119	14
β-strand	126	1	20
β-strand	131-137	7	23
β-strand	146-150	5	23
β-strand	156-158	3	23
β-strand	159	1	24
β-strand	161-165	5	22
α-helix	168-178	11
α-helix	188-199	12
β-strand	211-216	6	22
β-strand	220-223	4	22
α-helix	224-225	2
α-helix	226-235	10

Chain E: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15	1	25
α-helix	16	1
β-strand	21	1	25
α-helix	22-31	10
α-helix	35-36	2
β-strand	37-41	5	26
β-strand	46-51	6	26
β-strand	59	1	24
α-helix	61-63	3
β-strand	67-71	5	27
β-strand	74-80	7	27
α-helix	82-103	22
α-helix	106-108	3
α-helix	109-117	9
β-strand	140-148	9	27
β-strand	152-158	7	27
β-strand	164-166	3	27
β-strand	167	1	28
β-strand	169-172	4	26
α-helix	176-186	11
α-helix	193-207	15
α-helix	211-212	2
β-strand	217-223	7	26
β-strand	227-230	4	26
α-helix	233-241	9

Chains F and T: 10 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	20-30	11
α-helix	33-34	2
β-strand	35-39	5	29
β-strand	43-49	7	29
β-strand	52	1	30
β-strand	57	1	28
β-strand	59	1	30
α-helix	60-61	2
β-strand	63-65	3	31
β-strand	70-76	7	31
α-helix	78-99	22
α-helix	102-104	3
α-helix	105-121	17
β-strand	122	1	32
β-strand	130-138	9	31
β-strand	141-147	7	31
β-strand	153-155	3	31
β-strand	156	1	33
β-strand	158-161	4	29
α-helix	165-179	15
α-helix	186-198	13
α-helix	204-206	3
β-strand	211-217	7	29
β-strand	223-225	3	29
α-helix	227-230	4

14 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proteasome subunit alpha type-1	A, O	protein	252	Saccharomyces cerevisiae S288C	P21243 (AlphaFold model)
Proteasome subunit alpha type-2	B, P	protein	250	Saccharomyces cerevisiae S288C	P23639 (AlphaFold model)
Proteasome subunit alpha type-3	C, Q	protein	258	Saccharomyces cerevisiae S288C	P23638 (AlphaFold model)
Proteasome subunit alpha type-4	D, R	protein	254	Saccharomyces cerevisiae S288C	P40303 (AlphaFold model)
Proteasome subunit alpha type-5	E, S	protein	260	Saccharomyces cerevisiae S288C	P32379
Proteasome subunit alpha type-6	F, T	protein	234	Saccharomyces cerevisiae S288C	P40302
Proteasome subunit alpha type-7	G, U	protein	288	Saccharomyces cerevisiae S288C	P21242
Proteasome subunit beta type-1	H, V	protein	215	Saccharomyces cerevisiae S288C	P38624
Proteasome subunit beta type-2	I, W	protein	261	Saccharomyces cerevisiae S288C	P25043
Proteasome subunit beta type-3	J, X	protein	205	Saccharomyces cerevisiae S288C	P25451
Proteasome subunit beta type-4	K, Y	protein	198	Saccharomyces cerevisiae S288C	P22141
Proteasome subunit beta type-5	L, Z	protein	287	Saccharomyces cerevisiae S288C	P30656

2 more molecules are not listed.

Sequence of entity 1 (A, O), FASTA

>8T0M_1 Proteasome subunit alpha type-1 (chains A, O)
MSGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVP
DKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKR
MANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITT
NLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAEN
IEERLVAIAEQD

Sequence of entity 2 (B, P), FASTA

>8T0M_2 Proteasome subunit alpha type-2 (chains B, P)
MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSET
LSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQE
ATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWN
DELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTS
QEINDRLEAL

Sequence of entity 3 (C, Q), FASTA

>8T0M_3 Proteasome subunit alpha type-3 (chains C, Q)
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV
KTGITKKDEDEEADEDMK

Sequence of entity 4 (D, R), FASTA

>8T0M_4 Proteasome subunit alpha type-4 (chains D, R)
MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRIT
PSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRY
TQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYD
RKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEK
QEQQEQDKKKKSNH

Sequence of entity 5 (E, S), FASTA

>8T0M_5 Proteasome subunit alpha type-5 (chains E, S)
MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLE
SDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLA
LRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQ
AELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELI
KELKEKEAAESPEEADVEMS

Sequence of entity 6 (F, T), FASTA

>8T0M_6 Proteasome subunit alpha type-6 (chains F, T)
MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQ
KKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNT
QSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFI
KIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI

Sequence of entity 7 (G, U), FASTA

>8T0M_7 Proteasome subunit alpha type-7 (chains G, U)
MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLV
PQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYV
QAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLV
DHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAI
DFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE

Sequence of entity 8 (H, V), FASTA

>8T0M_8 Proteasome subunit beta type-1 (chains H, V)
MNGIQVDINRLKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKI
WCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAG
YDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ
AIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL

Sequence of entity 9 (I, W), FASTA

>8T0M_9 Proteasome subunit beta type-2 (chains I, W)
MAGLSFDNYQRNNFLAENSHTQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNC
AKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQ
GHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEA
IKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTA
VLKESIVNICDIQEEQVDITA

Sequence of entity 10 (J, X), FASTA

>8T0M_10 Proteasome subunit beta type-3 (chains J, X)
MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDV
TTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPF
IAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDAL
SGWGAVVYIIKKDEVVKRYLKMRQD

Sequence of entity 11 (K, Y), FASTA

>8T0M_11 Proteasome subunit beta type-4 (chains K, Y)
MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYI
QANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQID
YLGTKVELPYGAHGYSGFYTFFLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVI
VKIVDKDGIRQVDDFQAQ

Sequence of entity 12 (L, Z), FASTA

>8T0M_12 Proteasome subunit beta type-5 (chains L, Z)
MQAIADSFSVPNRLVKELQYDNEQNLESDFVTGASQFQRLAPSLTVPPIASPQQFLRAHT
DDSRNPDCKIKIAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTM
AGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYT
RKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAA
HRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG

Primary citation

Structure of the preholoproteasome reveals late steps in proteasome core particle biogenesis. Walsh Jr., R.M., Rawson, S., Schnell, H.M. et al. Nat Struct Mol Biol (2023) 30:1516-1524. DOI 10.1038/s41594-023-01081-w · PubMed

Other PDB entries of the same protein (UniProt P21243 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RYP 1.9 Å, Crystal structure of the 20S proteasome from yeast at 2.4 Å resolution
8RVQ 2.02 Å, 20S proteasome from pre1-1
4R17 2.1 Å, Ligand-induced aziridine-formation at subunit beta5 of the yeast 20S proteasome
8RVL 2.14 Å, Proteasomal late precursor complex from pre1-1
8U7U 2.16 Å, Proteasome 20S Core Particle from Beta 3 D205 deletion
1G65 2.25 Å, Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity…
8RVP 2.28 Å, Proteasomal late precursor complex from pre1-1, state 2
4QVP 2.3 Å, yCP beta5-M45T mutant in complex with bortezomib
5CZ4 2.3 Å, Yeast 20S proteasome at 2.3 A resolution
6HWE 2.3 Å, Yeast 20S proteasome beta2-G45A mutant in complex with carfilzomib
9GBK 2.39 Å, Blm10-20S proteasome complex from pre1-1
1G0U 2.4 Å, A gated channel into the proteasome core particle

Browse structure collections

About this viewer

MolViewer shows 8T0M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.