8T0P: Cse4

Structure of Cse4 bound to Ame1 and Okp1. Determined by X-ray diffraction at 1.73 Å resolution. Released 27 Sept 2023.

Method: X-ray diffraction
Resolution: 1.73 Å
Organism: Saccharomyces cerevisiae
Chains: 3
Atoms: 2,492
Mol. weight: 33.77 kDa
Released: 27 Sept 2023

Explore 8T0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8T0P contains 13 α-helices and 2 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	130-141	12
α-helix	146-148	3
β-strand	151-152	2	1
α-helix	153-155	3
α-helix	156-180	25
α-helix	182-188	7
α-helix	193-219	27
β-strand	223-224	2	1
α-helix	229-232	4
α-helix	234-273	40

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	129-145	17
α-helix	146-150	5
α-helix	151-159	9
α-helix	165-230	66

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	34-47	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Inner kinetochore subunit AME1	B	protein	107	Saccharomyces cerevisiae	P38313 (AlphaFold model)
Inner kinetochore subunit OKP1	A	protein	152	Saccharomyces cerevisiae	P53298 (AlphaFold model)
Histone H3-like centromeric protein CSE4	C	protein	18	Saccharomyces cerevisiae	P36012 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>8T0P_1 Inner kinetochore subunit AME1 (chains B)
LSSSITSVTTIDVLSSLFINLFENDLIPQALKDFNKSDDDQFRKLLYKLDLRLFQTISDQ
MTRDLKDILDINVSNNELCYQLKQVLARKEDLNQQIISVRNEIQELK

Sequence of entity 2 (A), FASTA

>8T0P_2 Inner kinetochore subunit OKP1 (chains A)
SVRPWEFRKVIQAEYRERLPRNYELKHWKKPSKIMIGSILRLLETNTVSALDSVFEKYEK
EMNQMTHGDNNEVKRIYSKKERLLEIILTKIKKKLRQAKFPSRISERDLDIEYIYSKRQF
IQNRYSQELQNNERLEAILSREQNLLEETRKL

Sequence of entity 3 (C), FASTA

>8T0P_3 Histone H3-like centromeric protein CSE4 (chains C)
QSINDRALSLLQRTRATK

Primary citation

Recognition of centromere-specific histone Cse4 by the inner kinetochore Okp1-Ame1 complex. Deng, S., Cai, J., Harrison, S.C. et al. EMBO Rep (2023) 24:e57702-e57702. DOI 10.15252/embr.202357702 · PubMed

Other PDB entries of the same protein (UniProt P38313 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OVW 3.4 Å, Cryo-EM structure of CBF1-CCAN bound topologically to centromeric DNA
8OVX 3.4 Å, Cryo-EM structure of yeast CENP-OPQU+ bound to the CENP-A N-terminus
8OW0 3.4 Å, Cryo-EM structure of CBF1-CCAN bound topologically to a centromeric CENP-A nucleosome
6QLF 3.45 Å, Structure of inner kinetochore CCAN complex with mask1
6QLE 3.55 Å, Structure of inner kinetochore CCAN complex
8OW1 3.7 Å, Cryo-EM structure of the yeast Inner kinetochore bound to a CENP-A nucleosome.
6QLD 4.15 Å, Structure of inner kinetochore CCAN-Cenp-A complex
6NUW 4.25 Å, Yeast Ctf19 complex

Browse structure collections

About this viewer

MolViewer shows 8T0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.