8T2M: GABARAP

Crystal structure of GABARAP in complex with the LIR of NSs4. Determined by X-ray diffraction at 1.27 Å resolution. Released 3 Apr 2024.

Method: X-ray diffraction
Resolution: 1.27 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,308
Mol. weight: 15.19 kDa
Released: 3 Apr 2024

Explore 8T2M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8T2M contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-68	12
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
α-helix	84-86	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein S,Gamma-aminobutyric acid receptor-associated protein chimera	A	protein	130	Homo sapiens	O95166 (AlphaFold model), P21698

Sequence of entity 1 (A), FASTA

>8T2M_1 Non-structural protein S,Gamma-aminobutyric acid receptor-associated protein chimera (chains A)
GSDDDGFVEVDGGMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKK
KYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYI
AYSDESVYGL

Primary citation

An LIR motif in the Rift Valley fever virus NSs protein is critical for the interaction with LC3 family members and inhibition of autophagy. Petraccione, K., Ali, M.G.H., Cyr, N. et al. PLoS Pathog (2024) 20:e1012093-e1012093. DOI 10.1371/journal.ppat.1012093 · PubMed

Other PDB entries of the same protein (UniProt O95166 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HYO 1.07 Å, Structure of ULK1 LIR motif bound to GABARAP
6YOP 1.1 Å, Structure of SAMM50 LIR bound to GABARAP
7ZKR 1.1 Å, Human GABARAP in complex with stapled peptide Pen3-ortho
6HYN 1.14 Å, Structure of ATG13 LIR motif bound to GABARAP
7AA8 1.25 Å, Structure of SCOC LIR bound to GABARAP
6HOG 1.26 Å, Structure of VPS34 LIR motif bound to GABARAP
3D32 1.3 Å, Complex of GABA(A) receptor-associated protein (GABARAP) with a synthetic peptide
6HB9 1.3 Å, Crystal structure of the GABARAP in complex with the UBA5 LIR motif
7BRQ 1.4 Å, Crystal structure of human FAM134B LIR fused to human GABARAP
9I9X 1.42 Å, Human GABARAP in complex with artificial peptide IM-2
9HGD 1.5 Å, Crystal structure of human GABARAP in complex with cyclic peptide GAB_D23
6HOJ 1.51 Å, Structure of Beclin1 LIR motif bound to GABARAP

Browse structure collections

About this viewer

MolViewer shows 8T2M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.