8T9Z: Fusion glycoprotein F0

Structural of M8C10 Fab in complex human metapneumovirus fusion protein. Determined by X-ray diffraction at 3.0 Å resolution. Released 22 Nov 2023.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Human metapneumovirus, Homo sapiens
Chains: 3
Atoms: 6,136
Mol. weight: 100.13 kDa
Released: 22 Nov 2023

Explore 8T9Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8T9Z contains 28 α-helices and 69 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	1
β-strand	29-40	12	1
β-strand	42-51	10	2
α-helix	66-89	24
α-helix	119-128	10
α-helix	131-143	13
β-strand	146-150	5	2
β-strand	156-162	7	2
α-helix	164-167	4
α-helix	168-173	6
α-helix	174-176	3
α-helix	177-179	3
α-helix	187-196	10
α-helix	198-210	13
β-strand	213-214	2	2
α-helix	224-232	9
α-helix	238-246	9
α-helix	248-254	7
β-strand	256-262	7	2
β-strand	266-275	10	2
β-strand	278-286	9	1
β-strand	288	1	1
β-strand	291	1	3
β-strand	302-303	2	3
β-strand	308-313	6	1
β-strand	316-320	5	1
β-strand	326-329	4	1
β-strand	332-336	5	1
β-strand	341-342	2	1
α-helix	345-351	7
β-strand	364-365	2	3
β-strand	372-376	5	4
β-strand	379-383	5	4
β-strand	390-393	4	5
β-strand	401-402	2	5
β-strand	407-411	5	4
α-helix	412-414	3
β-strand	417-420	4	5
β-strand	423-426	4	5

Chain H: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	11-12	2	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	45-51	7	8
β-strand	58-60	3	8
β-strand	69-73	5	6
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-101	10	8
β-strand	104-110	7	8
β-strand	111	1	6
β-strand	114-116	3	8
β-strand	117-118	2	7
β-strand	124	1	9
α-helix	125-126	2
β-strand	127-134	8	10
β-strand	142-152	11	10
β-strand	153	1	9
β-strand	158-161	4	11
α-helix	162-164	3
β-strand	171-172	2	10
α-helix	173-175	3
β-strand	176-177	2	10
β-strand	183-192	10	10
β-strand	202-207	6	11
β-strand	212-217	6	11

Chain L: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	12
β-strand	10-13	4	13
β-strand	19-25	7	12
β-strand	33-38	6	13
β-strand	45-50	6	13
β-strand	53-54	2	13
α-helix	55	1
β-strand	62-67	6	12
β-strand	70-75	6	12
α-helix	80-82	3
β-strand	85-90	6	13
α-helix	96	1
β-strand	98	1	13
β-strand	102-106	5	13
α-helix	107	1
β-strand	111	1	14
β-strand	114-118	5	15
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	15
β-strand	140	1	14
β-strand	145-150	6	16
β-strand	153-154	2	16
β-strand	161-163	3	15
α-helix	164-167	4
β-strand	173-182	10	15
α-helix	183-186	4
β-strand	191-197	7	16
β-strand	205-210	6	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion glycoprotein F0	A	protein	476	Human metapneumovirus	G3KCK8
M8C10 Fab Heavy Chain	H	protein	231	Homo sapiens
M8C10 Fab Light Chain	L	protein	214	Homo sapiens

Sequence of entity 1 (A), FASTA

>8T9Z_1 Fusion glycoprotein F0 (chains A)
LKESYLEESCSTITEGYLSVLRTGWYTNVFTLEVGDVENLTCTDGPSLIKTELDLTKSAL
RELKTVSADQLAREEQIENPRQSRFVLGAIALGVATAAAVTAGIAIAKTIRLESEVNAIK
GALKTTNEAVSTLGNGVRVLATAVRELKEFVSKNLTSAINKNKCDIADLKMAVSFSQFNR
RFLNVVRQFSDNAGITPAISLDLMTDAELARAVSYMPTSAGQIKLMLENRAMVRRKGFGI
LIGVYGSSVIYMVQLPIFGVIDTPCWIIKAAPSCSEKDGNYACLLREDQGWYCKNAGSTV
YYPNDKDCETRGDHVFCDTAAGINVAEQSRECNINISTTNYPCKVSTGRHPISMVALSPL
GALVACYKGVSCSIGSNRVGIIKQLPKGCSYITNQDADTVTIDNTVYQLSKVEGEQHVIK
GRPVSSSFDPIKFPEDQFNVALDQVFESIENSQALVDQSNKILNSAEKGNTGLVPR

Sequence of entity 2 (H), FASTA

>8T9Z_2 M8C10 Fab Heavy Chain (chains H)
QVQLVESGGGVVQPGRSLRLSCAASGFTFTTYTMHWVRQAPGKGLEWVALISSDGNNKYY
ADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCARGYYSGGDAFDVWGQGTMVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKHHHHHH

Sequence of entity 3 (L), FASTA

>8T9Z_3 M8C10 Fab Light Chain (chains L)
DIQMTQSPSTLSASVGDRVTITCRASQTITIWLAWYQQKPGKAPKLLIYDAVSLESGVPS
RFRGSGSGTDFTLTISSLQPDDFATYYCQQYNNYPYTFGQGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Structural characterization of M8C10, a neutralizing antibody targeting a highly conserved prefusion-specific epitope on the metapneumovirus fusion trimerization interface. Xiao, X., Wen, Z., Chen, Q. et al. J Virol (2023) 97:e0105223-e0105223. DOI 10.1128/jvi.01052-23 · PubMed

Other PDB entries of the same protein (UniProt G3KCK8), best resolution first:

8F6X 3.25 Å, cryo-EM structure of a structurally designed Human metapneumovirus F protein in complex…
4DAG 3.39 Å, Structure of the Human Metapneumovirus Fusion Protein with Neutralizing Antibody…

Browse structure collections

About this viewer

MolViewer shows 8T9Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.