8TAS: PRC2 monomer

PRC2 monomer bound to nucleosome. Determined by electron microscopy at 4.1 Å resolution. Released 25 Sept 2024.

Method: Electron microscopy
Resolution: 4.1 Å
Organisms: Homo sapiens, Xenopus laevis, synthetic construct
Chains: 15
Atoms: 29,440
Mol. weight: 533.58 kDa
Ligands: SAH
Released: 25 Sept 2024

Explore 8TAS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TAS contains 102 α-helices and 134 β-strands across 13 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 19 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	83-88	6
α-helix	91-106	16
β-strand	110	1	1
α-helix	112-114	3
α-helix	116-118	3
α-helix	134-145	12
β-strand	157-160	4	2
β-strand	162-165	4	3
β-strand	184-191	8	4
β-strand	203-211	9	4
β-strand	230-232	3	2
α-helix	239-244	6
α-helix	246-248	3
β-strand	249-253	5	4
β-strand	296-300	5	4
β-strand	302	1	5
β-strand	308	1	5
β-strand	314-318	5	3
β-strand	320	1	4
β-strand	354-358	5	3
β-strand	359-361	3	2
β-strand	428-434	7	6
β-strand	438-443	6	6
β-strand	449	1	7
β-strand	456	1	7
α-helix	460-470	11
β-strand	474-478	5	6
β-strand	485-491	7	6
α-helix	503-507	5
α-helix	509	1
β-strand	525-530	6	8
α-helix	536-538	3
α-helix	540-542	3
β-strand	557-560	4	8
β-strand	566-567	2	9
β-strand	572-573	2	9
α-helix	574-575	2
α-helix	576-578	3
α-helix	590-602	13
α-helix	608-624	17
α-helix	629-650	22
α-helix	653-665	13
α-helix	671-681	11

Chain E: 26 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	18-62	45
α-helix	66-68	3
β-strand	82-85	4	10
β-strand	86-87	2	11
α-helix	92-93	2
β-strand	94-97	4	10
β-strand	100	1	12
β-strand	114	1	13
β-strand	120-121	2	14
α-helix	168-179	12
α-helix	221-230	10
α-helix	237-247	11
α-helix	274-284	11
β-strand	285-286	2	15
β-strand	291-292	2	15
α-helix	334-343	10
α-helix	439-452	14
α-helix	456-462	7
α-helix	472-481	10
α-helix	483-485	3
α-helix	501-511	11
α-helix	512-516	5
α-helix	523-525	3
α-helix	540-543	4
α-helix	577-580	4
β-strand	583	1	16
α-helix	584-586	3
α-helix	610-613	4
β-strand	619-623	5	9
β-strand	629-633	5	9
β-strand	637	1	17
β-strand	642-643	2	16
β-strand	649-651	3	14
α-helix	653-665	13
β-strand	671-672	2	14
β-strand	679-681	3	14
β-strand	685	1	13
α-helix	688-691	4
α-helix	692	1
β-strand	693	1	18
α-helix	694	1
β-strand	700-707	8	16
β-strand	710-717	8	16
β-strand	721	1	17
α-helix	725	1
β-strand	726	1	9
α-helix	727	1
β-strand	728	1	18
α-helix	735-741	7

Chain G: 4 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	83-89	7	11
α-helix	94-96	3
β-strand	99-101	3	12
β-strand	112-116	5	12
β-strand	120-126	7	12
α-helix	128-130	3
β-strand	132-139	8	12
β-strand	147-154	8	19
β-strand	161-167	7	19
β-strand	172-175	4	19
β-strand	182-186	5	19
β-strand	193-198	6	20
β-strand	205-210	6	20
β-strand	214-219	6	20
β-strand	224-227	4	20
β-strand	228	1	21
β-strand	229-230	2	20
α-helix	231-233	3
β-strand	239-244	6	22
β-strand	250-255	6	22
β-strand	261-264	4	22
α-helix	268-279	12
β-strand	293	1	21
β-strand	299	1	22
β-strand	309-315	7	23
β-strand	318-323	6	23
β-strand	328-333	6	23
β-strand	350-352	3	23
β-strand	367	1	11
β-strand	369-370	2	24
β-strand	376-379	4	24
β-strand	387-390	4	24
β-strand	402	1	24
β-strand	413-418	6	11
β-strand	424-429	6	11
β-strand	433-438	6	11

Chain I: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	27	1	14
α-helix	36-38	3
α-helix	41-42	2
α-helix	45-55	11
α-helix	64-78	15
β-strand	83-84	2	25
α-helix	86-113	28
β-strand	118-119	2	26
α-helix	121-130	10

Chain J: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	25-28	4
α-helix	31-40	10
β-strand	45-46	2	26
α-helix	50-75	26
β-strand	80-81	2	25
α-helix	84-92	9
β-strand	96-98	3	27

Chain O: 9 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	5-27	23
α-helix	28-30	3
β-strand	32-39	8	8
β-strand	47-49	3	34
β-strand	54	1	34
β-strand	61-68	8	34
β-strand	77-87	11	34
β-strand	115-123	9	34
β-strand	129-133	5	35
β-strand	136-143	8	35
β-strand	149	1	36
β-strand	150-153	4	35
α-helix	161-162	2
β-strand	172-173	2	36
β-strand	183-185	3	37
β-strand	192-196	5	37
β-strand	202-206	5	37
α-helix	207-209	3
β-strand	216-217	2	36
α-helix	218-219	2
β-strand	221-223	3	37
β-strand	230-235	6	38
β-strand	242-247	6	38
β-strand	251-256	6	38
β-strand	267-270	4	38
β-strand	280-281	2	39
β-strand	288-292	5	39
β-strand	298-302	5	39
β-strand	311-313	3	39
β-strand	320-325	6	1
β-strand	332-337	6	1
β-strand	342-346	5	1
α-helix	347-349	3
α-helix	356-359	4
β-strand	366-370	5	1
α-helix	376	1
β-strand	377-383	7	8
β-strand	386-394	9	8
β-strand	398-404	7	8
α-helix	406-409	4

Chain R: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	17-20	4
α-helix	27-35	9
β-strand	42-43	2	28
α-helix	47-72	26
β-strand	77-78	2	29
α-helix	80-89	10
α-helix	91-94	4
β-strand	100-102	3	27

Chain S: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	35-45	11
β-strand	50-51	2	29
α-helix	54-80	27
β-strand	85-86	2	28
α-helix	88-98	11
α-helix	102-120	19

5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polycomb protein SUZ12	D	protein	619	Homo sapiens	Q15022 (AlphaFold model)
Histone-lysine N-methyltransferase EZH2	E	protein	753	Homo sapiens	Q15910 (AlphaFold model)
Polycomb protein EED	G	protein	441	Homo sapiens	O75530 (AlphaFold model)
Histone H3.2	I, W	protein	136	Xenopus laevis	P84233 (AlphaFold model)
DNA (226-mer)	H	DNA	215	synthetic construct
Histone H4	J, X	protein	106	Xenopus laevis	P62799
Histone H2A	R, U	protein	133	Xenopus laevis	P06897
Histone H2B 1.1	S, V	protein	123	Xenopus laevis	P02281
DNA (226-mer)	T	DNA	215	synthetic construct
Histone-binding protein RBBP4	O	protein	425	Homo sapiens	Q09028
Zinc finger protein AEBP2	Y	protein	303	Homo sapiens	Q6ZN18

Sequence of entity 1 (D), FASTA

>8TAS_1 Polycomb protein SUZ12 (chains D)
MVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTN
IKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEV
LLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVK
SYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNR
RLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETN
DKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKL
RIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGAR
IDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLES
EDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDV
NEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDF
NLISIMSIDKAVTKLREMQ

Sequence of entity 2 (E), FASTA

>8TAS_2 Histone-lysine N-methyltransferase EZH2 (chains E)
SNAGQTGKKSEKGPVACRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQ
EWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQ
NFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNAL
GQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAE
ELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHR
KCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGR
RRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSR
CQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKE
SSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSS
CPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADH
WDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADR
RGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAK
RAIQTGEELFFDYRYSQADALKYVGIEREMEIP

Sequence of entity 3 (G), FASTA

>8TAS_3 Polycomb protein EED (chains G)
MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTP
NAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNR
VTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITM
QCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVL
SADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS
TRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQ
CDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR
DSSILIAVCDDASIWRWDRLR

Sequence of entity 4 (I, W), FASTA

>8TAS_4 Histone H3.2 (chains I, W)
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA

Sequence of entity 5 (H), FASTA

>8TAS_5 DNA (226-MER) (chains H)
ATCGGGAGCTCCGACCGAATGACATGCATGCATACAGGATGTATATACCTGACACGTGCC
TGGAGACTAGGGAGTAACCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGT
TTAAGCGGTGCTAGAGCTGCCTACGACCAATGGAGCGGCCTCGGCACCGGGATCCCCCAG
CCGCCGGCAGCGCAGCGCCTGACGGGCACACAGTC

Sequence of entity 6 (J, X), FASTA

>8TAS_6 Histone H4 (chains J, X)
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGGSSG

Sequence of entity 7 (R, U), FASTA

>8TAS_7 Histone H2A (chains R, U)
SNAMSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLE
YLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLL
PKCTESSKSAKSK

Sequence of entity 8 (S, V), FASTA

>8TAS_8 Histone H2B 1.1 (chains S, V)
MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIM
NSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SAK

Sequence of entity 9 (T), FASTA

>8TAS_9 DNA (226-MER) (chains T)
GACTGTGTGCCCGTCAGACGCTGCGCCGCCGGCGGCCGGAGAATCCCGGTGCCGAGGCCG
CCCTATTGGTCGTAGACAGCCCCAGCACCGCCTAAACGCACGTACGCGCCGTCCCCCGCG
TTTTAACCGCCAAGGGGATTACCCCCCAGTCCCCAGGCACGTGCCAGATATATACATCCC
GTACGCACGCACATCATTCGATCGGAGCTCCCGAT

Sequence of entity 10 (O), FASTA

>8TAS_10 Histone-binding protein RBBP4 (chains O)
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD
FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG
YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE
SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE
DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS

Sequence of entity 11 (Y), FASTA

>8TAS_11 Zinc finger protein AEBP2 (chains Y)
SNAYTRRYSSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNS
SPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGG
CNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRP
HDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPE
DILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRTLIRKVFNLYL
SKQ

Ligands and cofactors

ID	Name	Formula	Copies
SAH	S-adenosyl-L-homocysteine	C14 H20 N6 O5 S	1

Primary citation

Activation of automethylated PRC2 by dimerization on chromatin. Sauer, P.V., Pavlenko, E., Cookis, T. et al. Mol Cell (2024) 84:3885-3898.e8. DOI 10.1016/j.molcel.2024.08.025 · PubMed

Other PDB entries of the same protein (UniProt Q15022 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IJ7 2.62 Å, Structure of Hs/AcPRC2 in complex with a pyridone inhibitor
9XZI 2.69 Å, Crystal Structure of the SUZ12-RBBP4-PHF19-EPOP PRC2.1 Subcomplex
4W2R 2.81 Å, Structure of Hs/AcPRC2 in complex with 5,8-dichloro-2-[(4-methoxy-6-methyl-2-oxo-1,2-dihy…
6NQ3 2.89 Å, Crystal Structure of a SUZ12-RBBP4-PHF19-JARID2 Heterotetrameric Complex
5WAI 2.9 Å, Crystal Structure of a Suz12-Rbbp4-Jarid2-Aebp2 Heterotetrameric Complex
5HYN 2.95 Å, Structure of Human Polycomb Repressive Complex 2 (PRC2) with oncogenic histone H3K27M…
5IJ8 2.99 Å, Structure of the primary oncogenic mutant Y641N Hs/AcPRC2 in complex with a pyridone…
7TD5 2.99 Å, Structure of human PRC2-EZH1 containing phosphorylated SUZ12
6B3W 3.05 Å, Structure of Hs/AcPRC2 in complex with 5,8-dichloro-7-(3,5-dimethyl-1,2-oxazol-4-yl)-2-[(…
9KOF 3.07 Å, Structure of human PRC2 with SAH and H3K27me3 peptide
8VMI 3.1 Å, PRC2_AJ119-450 bound to H3K4me3
8VNV 3.1 Å, PRC2_AJ1-450 bound to H3K36me3 with histone H3 tail engaged

Browse structure collections

About this viewer

MolViewer shows 8TAS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.