8TGF: CEPG5 LIR/LGG-1 complex

Crystal structure of cEPG5 LIR/LGG-1 complex. Determined by X-ray diffraction at 1.6 Å resolution. Released 17 Jul 2024.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Caenorhabditis elegans
Chains: 2
Atoms: 1,079
Mol. weight: 16.27 kDa
Released: 17 Jul 2024

Explore 8TGF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TGF contains 6 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	42-44	3
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-68	12
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
α-helix	84-86	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	508-509	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein lgg-1	A	protein	125	Caenorhabditis elegans	Q09490 (AlphaFold model)
Ectopic P granules protein 5	B	protein	11	Caenorhabditis elegans	Q18892 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8TGF_1 Protein lgg-1 (chains A)
GSMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVG
QFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGE
VEKKE

Sequence of entity 2 (B), FASTA

>8TGF_2 Ectopic P granules protein 5 (chains B)
STWEILADDDD

Primary citation

Structure of the human autophagy factor EPG5 and the molecular basis of its conserved mode of interaction with Atg8-family proteins. Cheung, Y.W.S., Nam, S.E., Fairlie, G.M.J. et al. Autophagy (2025) 21:1173-1191. DOI 10.1080/15548627.2024.2447213 · PubMed

Other PDB entries of the same protein (UniProt Q09490 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AZF 1.6 Å, Crystal structure of LGG-1 complexed with a WEEL peptide
5AZG 1.81 Å, Crystal structure of LGG-1 complexed with a UNC-51 peptide
8TGX 2.62 Å, Crystal structure of C. elegans LGG-1

Browse structure collections

About this viewer

MolViewer shows 8TGF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.