Crystal structure of C. elegans LGG-1. Determined by X-ray diffraction at 2.62 Å resolution. Released 22 Jan 2025.
Explore 8TGX in 3D Show helices and sheets RCSB PDB PDBe
8TGX contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-8 | 5 | |
| α-helix | 11-24 | 14 | |
| β-strand | 28-35 | 8 | 1 |
| α-helix | 36 | 1 | |
| α-helix | 42-44 | 3 | |
| β-strand | 48-52 | 5 | 1 |
| β-strand | 56 | 1 | 2 |
| α-helix | 57-68 | 12 | |
| β-strand | 77-79 | 3 | 1 |
| β-strand | 80 | 1 | 3 |
| β-strand | 83 | 1 | 3 |
| α-helix | 84-86 | 3 | |
| β-strand | 90 | 1 | 2 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-110 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein lgg-1 | A | protein | 125 | Caenorhabditis elegans | Q09490 (AlphaFold model) |
>8TGX_1 Protein lgg-1 (chains A) GSMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVG QFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGE VEKKE
Structure of the human autophagy factor EPG5 and the molecular basis of its conserved mode of interaction with Atg8-family proteins. Cheung, Y.W.S., Nam, S.E., Fairlie, G.M.J. et al. Autophagy (2025) 21:1173-1191. DOI 10.1080/15548627.2024.2447213 · PubMed
Other PDB entries of the same protein (UniProt Q09490 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8TGX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.