Solution structure of the zinc finger repeat domain of BCL11A (ZnF456). Determined by solution NMR. Released 24 Jul 2024.
Explore 8THO in 3D Show helices and sheets RCSB PDB PDBe
8THO contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 1 |
| β-strand | 15 | 1 | 1 |
| α-helix | 19-29 | 11 | |
| α-helix | 48-55 | 8 | |
| β-strand | 66 | 1 | 2 |
| β-strand | 73 | 1 | 2 |
| α-helix | 77-87 | 11 | |
| β-strand | 88 | 1 | 3 |
| β-strand | 91 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| B-cell lymphoma/leukemia 11A | A | protein | 100 | Homo sapiens | Q9H165 (AlphaFold model) |
>8THO_1 B-cell lymphoma/leukemia 11A (chains A) SEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQV GKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Structural insights into the DNA-binding mechanism of BCL11A: The integral role of ZnF6. Viennet, T., Yin, M., Jayaraj, A. et al. Structure (2024) 32:2276-2286.e4. DOI 10.1016/j.str.2024.09.022 · PubMed
Other PDB entries of the same protein (UniProt Q9H165 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8THO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.