8TIE: Nucleoporin NUP120

Double nuclear outer ring of Nup84-complexes from the yeast NPC. Determined by electron microscopy at 8.1 Å resolution. Released 11 Oct 2023.

Method: Electron microscopy
Resolution: 8.1 Å
Organism: Saccharomyces cerevisiae
Chains: 14
Atoms: 76,621
Mol. weight: 1272.5 kDa
Released: 11 Oct 2023

Explore 8TIE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TIE contains 392 α-helices and 267 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 40 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	6-10	5	2
β-strand	23-27	5	3
β-strand	56-61	6	3
β-strand	67-73	7	3
β-strand	78-83	6	3
β-strand	92-96	5	3
β-strand	108-113	6	4
β-strand	116-123	8	4
β-strand	127-134	8	4
α-helix	135-139	5
β-strand	150-153	4	4
β-strand	163-170	8	5
β-strand	173-178	6	5
β-strand	183-189	7	5
β-strand	193-197	5	5
β-strand	223-229	7	6
β-strand	233-238	6	6
β-strand	243-247	5	6
β-strand	252-257	6	6
β-strand	270	1	7
β-strand	280-283	4	8
β-strand	286-290	5	8
β-strand	293	1	7
β-strand	294	1	9
β-strand	296	1	9
β-strand	297-306	10	8
β-strand	310-320	11	8
β-strand	330-337	8	10
β-strand	349-357	9	10
β-strand	360-368	9	10
β-strand	376-380	5	10
β-strand	382	1	1
α-helix	386-393	8
α-helix	404-414	11
α-helix	417-429	13
α-helix	440-457	18
β-strand	460-466	7	2
β-strand	470-475	6	2
β-strand	480-484	5	2
α-helix	489-495	7
α-helix	505-517	13
α-helix	522-537	16
α-helix	546-553	8
α-helix	554-558	5
α-helix	564-576	13
α-helix	579-586	8
α-helix	587-591	5
α-helix	598-600	3
α-helix	602-604	3
α-helix	609-639	31
α-helix	648-670	23
α-helix	672-683	12
α-helix	695-710	16
α-helix	718-724	7
α-helix	725-729	5
α-helix	734-740	7
α-helix	741-745	5
α-helix	754-766	13
α-helix	770-777	8
α-helix	782-785	4
α-helix	792-798	7
α-helix	809-812	4
α-helix	813-815	3
α-helix	820-834	15
α-helix	838-854	17
α-helix	862-879	18
α-helix	882-890	9
α-helix	898-910	13
α-helix	912-930	19
α-helix	939-950	12
α-helix	958-970	13
α-helix	974-987	14
α-helix	993-1009	17
β-strand	1017-1020	4	11
β-strand	1023-1026	4	11
α-helix	1027-1036	10

Chain b: 34 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	67-70	4	12
β-strand	78-82	5	12
β-strand	89-93	5	12
α-helix	103-116	14
α-helix	144-164	21
α-helix	169-189	21
α-helix	201-212	12
α-helix	221-228	8
α-helix	239-241	3
α-helix	243-254	12
α-helix	258-268	11
α-helix	270-276	7
α-helix	279-293	15
α-helix	300-319	20
α-helix	326-339	14
α-helix	343-348	6
α-helix	353-363	11
α-helix	371-381	11
α-helix	391-398	8
α-helix	406-412	7
α-helix	414-426	13
α-helix	461-474	14
α-helix	482-491	10
α-helix	497-507	11
α-helix	516-529	14
α-helix	532-548	17
α-helix	552-561	10
α-helix	565-582	18
α-helix	589-595	7
α-helix	609-614	6
α-helix	619-638	20
α-helix	642-653	12
α-helix	664-666	3
α-helix	667-676	10
α-helix	685-698	14
α-helix	704-716	13
α-helix	724-742	19

Chain c: 35 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	103-127	25
α-helix	129-141	13
β-strand	161	1	13
β-strand	166	1	14
β-strand	170	1	13
α-helix	174-177	4
α-helix	182-185	4
α-helix	187-192	6
β-strand	201	1	15
β-strand	208	1	15
α-helix	229-241	13
α-helix	253-275	23
α-helix	277-286	10
α-helix	290-297	8
α-helix	303-312	10
α-helix	316-322	7
α-helix	330-346	17
α-helix	352-362	11
α-helix	373-377	5
α-helix	381-390	10
α-helix	399-409	11
α-helix	411-413	3
α-helix	417-426	10
α-helix	431-439	9
α-helix	447-458	12
α-helix	469-484	16
α-helix	488-494	7
α-helix	500-512	13
α-helix	516-518	3
α-helix	523-529	7
α-helix	534-548	15
α-helix	551-560	10
α-helix	564-572	9
α-helix	591-596	6
α-helix	606-608	3
α-helix	613-624	12
α-helix	630-644	15
α-helix	653-669	17
α-helix	677-685	9
α-helix	690-707	18

Chain d: 2 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	14
β-strand	14-17	4	16
β-strand	23-27	5	16
β-strand	32-39	8	16
β-strand	42-45	4	16
β-strand	49-50	2	16
β-strand	56-61	6	17
α-helix	62-63	2
β-strand	70-74	5	17
β-strand	78-82	5	17
β-strand	91-94	4	17
β-strand	102-107	6	18
β-strand	115-120	6	18
β-strand	125-129	5	18
β-strand	139-141	3	18
β-strand	148-151	4	19
β-strand	175-177	3	19
β-strand	182-183	2	19
β-strand	200	1	19
β-strand	207-212	6	20
β-strand	222-226	5	20
β-strand	231-235	5	20
β-strand	244-247	4	20
α-helix	252-253	2
β-strand	260-262	3	21
β-strand	269-273	5	21
β-strand	277-283	7	21
β-strand	289-291	3	21

Chain e: 5 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	12
β-strand	12-17	6	22
β-strand	23-28	6	22
β-strand	32-39	8	22
β-strand	44-52	9	22
β-strand	58-63	6	23
α-helix	64-65	2
α-helix	66-68	3
β-strand	71-76	6	23
β-strand	80-85	6	23
β-strand	99-104	6	23
α-helix	110	1
β-strand	111-117	7	24
α-helix	119-121	3
β-strand	124-129	6	24
β-strand	133-136	4	24
β-strand	152-155	4	24
β-strand	169-173	5	25
β-strand	183-187	5	25
β-strand	190-192	3	25
β-strand	207	1	25
β-strand	215-220	6	26
α-helix	221-222	2
β-strand	229-235	7	26
β-strand	240-246	7	26
β-strand	293-300	8	26
β-strand	310-312	3	27
β-strand	319-322	4	27
β-strand	328-333	6	27
β-strand	339-345	7	27

Chain f: 40 helices, 0 β-strands

Element	Residues	Length
α-helix	5-26	22
α-helix	37-56	20
α-helix	59-85	27
α-helix	102-112	11
α-helix	114-128	15
α-helix	133-136	4
α-helix	145-150	6
α-helix	160-162	3
α-helix	171-190	20
α-helix	193-202	10
α-helix	207-213	7
α-helix	240-251	12
α-helix	258-267	10
α-helix	271-273	3
α-helix	274-277	4
α-helix	282-304	23
α-helix	317-319	3
α-helix	324-334	11
α-helix	342-352	11
α-helix	355-371	17
α-helix	383-395	13
α-helix	406-422	17
α-helix	429-432	4
α-helix	438-448	11
α-helix	452-454	3
α-helix	457-464	8
α-helix	477-485	9
α-helix	505-520	16
α-helix	523-540	18
α-helix	543-552	10
α-helix	557-568	12
α-helix	579-604	26
α-helix	613-638	26
α-helix	639-643	5
α-helix	649-669	21
α-helix	672-678	7
α-helix	682-689	8
α-helix	691-695	5
α-helix	701-708	8
α-helix	711-722	12

Chain g: 44 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	2-15	14
α-helix	26-51	26
β-strand	59-63	5	28
β-strand	67-71	5	28
β-strand	87-90	4	29
β-strand	96-100	5	29
β-strand	104-109	6	29
β-strand	119-123	5	29
α-helix	135-136	2
β-strand	137-140	4	30
β-strand	164-168	5	30
β-strand	171-175	5	30
α-helix	189-192	4
β-strand	193-197	5	30
β-strand	208-213	6	31
β-strand	219-223	5	31
β-strand	228-234	7	31
β-strand	240-247	8	31
β-strand	269-275	7	32
β-strand	281-286	6	32
β-strand	291-296	6	32
β-strand	306-311	6	32
α-helix	316-318	3
β-strand	331-338	8	33
β-strand	344-353	10	33
β-strand	358-369	12	33
β-strand	374-383	10	33
β-strand	398-400	3	34
β-strand	415-419	5	34
β-strand	424-428	5	34
β-strand	445-447	3	34
α-helix	448	1
β-strand	449	1	35
α-helix	450	1
β-strand	455-460	6	28
β-strand	464-469	6	28
β-strand	473-479	7	28
α-helix	482-484	3
α-helix	493-503	11
β-strand	512	1	35
α-helix	524-539	16
α-helix	553-574	22
α-helix	581-604	24
α-helix	608-623	16
α-helix	633-636	4
α-helix	647-657	11
α-helix	664-690	27
α-helix	691-694	4
α-helix	712-732	21
α-helix	735-738	4
α-helix	739-760	22
α-helix	765-770	6
α-helix	772-782	11
α-helix	785-794	10
α-helix	798-808	11
α-helix	811-818	8
α-helix	826-838	13
α-helix	842-853	12
α-helix	857-862	6
α-helix	868-875	8
α-helix	886-892	7
α-helix	896-908	13
α-helix	917-931	15
α-helix	941-965	25
α-helix	970-972	3
α-helix	981-990	10
α-helix	999-1006	8
α-helix	1016-1024	9
α-helix	1026-1029	4
α-helix	1031-1049	19
α-helix	1057-1067	11
α-helix	1076-1078	3
α-helix	1083-1090	8
α-helix	1108-1123	16
α-helix	1129-1140	12
β-strand	1148-1149	2	36
β-strand	1154-1155	2	36

Chain l: 39 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	37
β-strand	23-27	5	38
β-strand	58-62	5	38
β-strand	66-73	8	38
β-strand	78-83	6	38
β-strand	92-96	5	38
β-strand	101	1	39
β-strand	108-113	6	40
β-strand	116-122	7	40
β-strand	123	1	39
β-strand	128-133	6	40
α-helix	135-139	5
β-strand	150-153	4	40
β-strand	163-170	8	41
β-strand	173-178	6	41
β-strand	183-187	5	41
β-strand	188-189	2	42
β-strand	193-194	2	42
α-helix	206-209	4
β-strand	225-229	5	43
β-strand	233-237	5	43
β-strand	243-247	5	43
β-strand	252-257	6	43
β-strand	270	1	44
β-strand	280-283	4	45
β-strand	286-291	6	45
β-strand	293	1	44
β-strand	297-306	10	45
β-strand	310-320	11	45
α-helix	325-327	3
β-strand	330-337	8	46
β-strand	349-356	8	46
β-strand	362-368	7	46
β-strand	376-381	6	46
α-helix	386-391	6
α-helix	404-412	9
α-helix	418-429	12
α-helix	441-457	17
β-strand	460-466	7	37
β-strand	470-475	6	37
β-strand	480-485	6	37
α-helix	489-495	7
α-helix	507-517	11
α-helix	525-535	11
α-helix	546-553	8
α-helix	554-558	5
α-helix	566-574	9
α-helix	585-586	2
α-helix	587-591	5
β-strand	602	1	47
α-helix	609-639	31
α-helix	648-670	23
α-helix	672-681	10
β-strand	691	1	47
α-helix	695-711	17
α-helix	718-724	7
α-helix	725-729	5
α-helix	734-740	7
α-helix	741-745	5
α-helix	754-767	14
α-helix	770-776	7
α-helix	782-785	4
α-helix	808-813	6
α-helix	822-834	13
α-helix	838-854	17
α-helix	862-877	16
α-helix	883-890	8
α-helix	898-910	13
α-helix	912-930	19
α-helix	939-952	14
α-helix	953-955	3
α-helix	958-970	13
α-helix	974-987	14
α-helix	993-1008	16
β-strand	1018-1020	3	48
β-strand	1023-1025	3	48
α-helix	1027-1036	10

6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin NUP120	a, l	protein	1037	Saccharomyces cerevisiae	P35729 (AlphaFold model)
Nucleoporin NUP85	b, m	protein	744	Saccharomyces cerevisiae	P46673 (AlphaFold model)
NUP145 isoform 1	c, n	protein	1317	Saccharomyces cerevisiae	P49687 (AlphaFold model)
Protein transport protein SEC13	d, o	protein	297	Saccharomyces cerevisiae	Q04491 (AlphaFold model)
Nucleoporin Seh1	e, p	protein	307	Saccharomyces cerevisiae	P53011
Nucleoporin NUP84	f, q	protein	726	Saccharomyces cerevisiae	P52891
NUP133 isoform 1	g, r	protein	1157	Saccharomyces cerevisiae	P36161

Sequence of entity 1 (a, l), FASTA

>8TIE_1 Nucleoporin NUP120 (chains a, l)
MACLSRIDANLLQYYEKPEPNNTVDLYVSNNSNNNGLKEGDKSISTPVPQPYGSEYSNCL
LLSNSEYICYHFSSRSTLLTFYPLSDAYHGKTINIHLPNASMNQRYTLTIQEVEQQLLVN
VILKDGSFLTLQLPLSFLFSSANTLNGEWFHLQNPYDFTVRVPHFLFYVSPQFSVVFLED
GGLLGLKKVDGVHYEPLLFNDNSYLKSLTRFFSRSSKSDYDSVISCKLFHERYLIVLTQN
CHLKIWDLTSFTLIQDYDMVSQSDSDPSHFRKVEAVGEYLSLYNNTLVTLLPLENGLFQM
GTLLVDSSGILTYTFQNNIPTNLSASAIWSIVDLVLTRPLELNVEASYLNLIVLWKSGTA
SKLQILNVNDESFKNYEWIESVNKSLVDLQSEHDLDIVTKTGDVERGFCNLKSRYGTQIF
ERAQQILSENKIIMAHNEDEEYLANLETILRDVKTAFNEASSITLYGDEIILVNCFQPYN
HSLYKLNTTVENWFYNMHSETDGSELFKYLRTLNGFASTLSNDVLRSISKKFLDIITGEL
PDSMTTVEKFTDIFKNCLENQFEITNLKILFDELNSFDIPVVLNDLINNQMKPGIFWKKD
FISAIKFDGFTSIISLESLHQLLSIHYRITLQVLLTFVLFDLDTEIFGQHISTLLDLHYK
QFLLLNLYRQDKCLLAEVLLKDSSEFSFGVKFFNYGQLIAYIDSLNSNVYNASITENSFF
MTFFRSYIIENTSHKNIRFFLENVECPFYLRHNEVQEFMFAMTLFSCGNFDQSYEIFQLH
DYPEAINDKLPTFLEDLKSENYHGDSIWKDLLCTFTVPYRHSAFYYQLSLLFDRNNSQEF
ALKCISKSAEYSLKEIQIEELQDFKEKQHIHYLNLLIHFRMFEEVLDVLRLGHECLSDTV
RTNFLQLLLQEDIYSRDFFSTLLRLCNAHSDNGELYLRTVDIKIVDSILSQNLRSGDWEC
FKKLYCFRMLNKSERAAAEVLYQYILMQADLDVIRKRKCYLMVINVLSSFDSAYDQWILN
GSKVVTLTDLRDELRGL

Sequence of entity 2 (b, m), FASTA

>8TIE_2 Nucleoporin NUP85 (chains b, m)
MTIDDSNRLLMDVDQFDFLDDGTAQLSNNKTDEEEQLYKRDPVSGAILVPMTVNDQPIEK
NGDKMPLKFKLGPLSYQNMAFITAKDKYKLYPVRIPRLDTSKEFSAYVSGLFEIYRDLGD
DRVFNVPTIGVVNSNFAKEHNATVNLAMEAILNELEVFIGRVKDQDGRVNRFYELEESLT
VLNCLRTMYFILDGQDVEENRSEFIESLLNWINRSDGEPDEEYIEQVFSVKDSTAGKKVF
ETQYFWKLLNQLVLRGLLSQAIGCIERSDLLPYLSDTCAVSFDAVSDSIELLKQYPKDSS
STFREWKNLVLKLSQAFGSSATDISGELRDYIEDFLLVIGGNQRKILQYSRTWYESFCGF
LLYYIPSLELSAEYLQMSLEANVVDITNDWEQPCVDIISGKIHSILPVMESLDSCTAAFT
AMICEAKGLIENIFEGEKNSDDYSNEDNEMLEDLFSYRNGMASYMLNSFAFELCSLGDKE
LWPVAIGLIALSATGTRSAKKMVIAELLPHYPFVTNDDIEWMLSICVEWRLPEIAKEIYT
TLGNQMLSAHNIIESIANFSRAGKYELVKSYSWLLFEASCMEGQKLDDPVLNAIVSKNSP
AEDDVIIPQDILDCVVTNSMRQTLAPYAVLSQFYELRDREDWGQALRLLLLLIEFPYLPK
HYLVLLVAKFLYPIFLLDDKKLMDEDSVATVIEVIETKWDDADEKSSNLYETIIEADKSL
PSSMATLLKNLRKKLNFKLCQAFM

Sequence of entity 3 (c, n), FASTA

>8TIE_3 NUP145 isoform 1 (chains c, n)
MFNKSVNSGFTFGNQNTSTPTSTPAQPSSSLQFPQKSTGLFGNVNVNANTSTPSPSGGLF
NANSNANSISQQPANNSLFGNKPAQPSGGLFGATNNTTSKSAGSLFGNNNATANSTGSTG
LFSGSNNIASSTQNGGLFGNSNNNNITSTTQNGGLFGKPTTTPAGAGGLFGNSSSTNSTT
GLFGSNNTQSSTGIFGQKPGASTTGGLFGNNGASFPRSGETTGTMSTNPYGINISNVPMA
VADMPRSITSSLSDVNGKSDAEPKPIENRRTYSFSSSVSGNAPLPLASQSSLVSRLSTRL
KATQKSTSPNEIFSPSYSKPWLNGAGSAPLVDDFFSSKMTSLAPNENSIFPQNGFNFLSS
QRADLTELRKLKIDSNRSAAKKLKLLSGTPAITKKHMQDEQDSSENEPIANADSVTNIDR
KENRDNNLDNTYLNGKEQSNNLNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQLAA
VSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGH
GLNVPAIITLENVYPVDKKTKKPMKDTTKFAEFQVFDRKLRSMREMNYISYNPFGGTWTF
KVNHFSIWGLVNEEDAEIDEDDLSKQEDGGEQPLRKVRTLAQSKPSDKEVILKTDGTFGT
LSGKDDSIVEEKAYEPDLSDADFEGIEASPKLDVSKDWVEQLILAGSSLRSVFATSKEFD
GPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKR
LPTELQRKFLFDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLW
KLSSILFDPVSYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQI
FLYLLLNDVVRASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNI
SKIYKLLSGSPFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPY
DDPIGVIFQLYAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDEAT
FAFAAQLEFAQLHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPS
QLIFNAQALKDRYEGNYLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTL
REILNEFPDSERDKWSVSINVFEVYLKLVLDNVETQETIDSLISGMKIFYDQYKHCREVA
ACCNVMSQEIVSKILEKNNPSIGDSKAKLLELPLGQPEKAYLRGEFAQDLMKCTYKI

Sequence of entity 4 (d, o), FASTA

>8TIE_4 Protein transport protein SEC13 (chains d, o)
MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS
SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ

Sequence of entity 5 (e, p), FASTA

>8TIE_5 Nucleoporin Seh1 (chains e, p)
MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVA
IDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAH
LGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSP
EKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRI
RIFKITEKNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCM
SVITAQQ

Sequence of entity 6 (f, q), FASTA

>8TIE_6 Nucleoporin NUP84 (chains f, q)
MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES
NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW
IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF
FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH
SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN
YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH
SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL
KLQGLYENIPIYATFLNESDCLEACSFILSSLEDPQVRKKQIETINFLRLPASNILRRTT
QRVFDETEQEYSPSNEISISFDVNNIDMHLIYGVEWLIEGKLYVDAVHSIIALSRRFLLN
GRVKALEQFMERNNIGEICKNYELEKIADNISKDENEDQFLEEITQYEHLIKGIREYEEW
QKSVSLLSSESNIPTLIEKLQGFSKDTFELIKTFLVDLTSSNFADSADYEILYEIRALYT
PFLLMELHKKLVEAAKLLKIPKFISEALAFTSLVANENDKIYLLFQSSGKLKEYLDLVAR
TATLSN

Sequence of entity 7 (g, r), FASTA

>8TIE_7 NUP133 isoform 1 (chains g, r)
MSEKKVHLRLRKELSVPIAVVENESLAQLSYEEESQASLMDISMEQQQLRLHSHFDNSKV
FTENNRYIVKTLQTDYSSGFSNDDELNGYIDMQIGYGLVNDHKKVYIWNIHSTQKDTPYI
TVPFRSDDNDEIAVAPRCILTFPATMDESPLALNPNDQDETGGLIIIKGSKAIYYEDINS
INNLNFKLSEKFSHELELPINSSGGEKCDLMLNCEPAGIVLSTNMGRIFFITIRNSMGKP
QLKLGKLLNKPFKLGIWSKIFNTNSSVVSLRNGPILGKGTRLVYITTNKGIFQTWQLSAT
NSHPTKLIDVNIYEAILESLQDLYPFAHGTLKIWDSHPLQDESSQLFLSSIYDSSCNETY
YILSTIIFDSSSNSFTIFSTYRLNTFMESITDTKFKPKIFIPQMENANDTNEVTSILVMF
PNAVVITQVNSKLDSSYSMRRKWEDIVSLRNDIDIIGSGYDSKSLYVLTKQMGVLQFFVK
ENEETNSKPEVGFVKSHVDQAVYFSKINANPIDFNLPPEISLDQESIEHDLKLTSEEIFH
SNGKYIPPMLNTLGQHLSVRKEFFQNFLTFVAKNFNYKISPELKLDLIEKFEILNCCIKF
NSIIRQSDVLNDIWEKTLSNYNLTQNEHLTTKTVVINSPDVFPVIFKQFLNHVVFVLFPS
QNQNFKLNVTNLINLCFYDGILEEGEKTIRYELLELDPMEVDTSKLPWFINFDYLNCINQ
CFFDFTFACEEEGSLDSYKEGLLKIVKILYYQFNQFKIWINTQPVKSVNANDNFININNL
YDDNHLDWNHVLCKVNLKEQCIQIAEFYKDLSGLVQTLQTLDQNDSTTVSLYETFFNEFP
KEFSFTLFEYLIKHKKLNDLIFRFPQQHDVLIQFFQESAPKYGHVAWIQQILDGSYADAM
NTLKNITVDDSKKGESLSECELHLNVAKLSSLLVEKDNLDINTLRKIQYNLDTIDAEKNI
SNKLKKGEVQICKRFKNGSIREVFNILVEELKSTTVVNLSDLVELYSMLDDEESLFIPLR
LLSVDGNLLNFEVKKFLNALVWRRIVLLNASNEGDKLLQHIVKRVFDEELPKNNDFPLPS
VDLLCDKSLLTPEYISETYGRFPIDQNAIREEIYEEISQVETLNSDNSLEIKLHSTIGSV
AKEKNYTINYETNTVEY

Primary citation

Implications of a multiscale structure of the yeast nuclear pore complex. Akey, C.W., Echeverria, I., Ouch, C. et al. Mol Cell (2023) 83:3283-3302.e5. DOI 10.1016/j.molcel.2023.08.025 · PubMed

Other PDB entries of the same protein (UniProt P35729 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3F7F 2.6 Å, Structure of Nup120
3H7N 3.0 Å, Structure of Nup120
3HXR 3.0 Å, Nucleoporin Nup120 from S.cerevisiae (aa 1-757)
6X06 4.27 Å, Nup120 (aa1-757) from S. cerevisiae bound by VHH-SAN11
4XMM 7.38 Å, Structure of the yeast coat nucleoporin complex, space group C2
4XMN 7.6 Å, Structure of the yeast coat nucleoporin complex, space group P212121
7N84 11.6 Å, Double nuclear outer ring from the isolated yeast NPC
7N9F 37.0 Å, Structure of the in situ yeast NPC
8ZZ1 Structure of the Nup84 sub-complex of the Nuclear Pore Complex
8ZZA Integrative structure and functional anatomy of a single spoke of a nuclear pore complex
8ZZB Integrative structure and functional anatomy of three spokes of a nuclear pore complex
8ZZC Integrative structure and functional anatomy of eight spokes of a nuclear pore complex

Browse structure collections

About this viewer

MolViewer shows 8TIE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.