8TIL: Human ACKR3 phosphorylated by GRK5

Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without receptor/micelle. Determined by electron microscopy at 3.8 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 3.8 Å
Organisms: synthetic construct, Homo sapiens, Bos taurus
Chains: 4
Atoms: 5,511
Mol. weight: 138.65 kDa
Released: 22 Jan 2025

Explore 8TIL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TIL contains 8 α-helices and 71 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	13
β-strand	19-23	5	13
β-strand	28-29	2	14
β-strand	30	1	15
β-strand	35	1	15
β-strand	38-44	7	13
α-helix	46-49	4
β-strand	53-63	11	16
β-strand	77-88	12	16
α-helix	100-107	8
β-strand	113-118	6	13
β-strand	128-130	3	17
β-strand	142	1	17
β-strand	143	1	16
β-strand	146-152	7	16
β-strand	165-167	3	16
β-strand	171-172	2	14
β-strand	184-188	5	18
β-strand	198-204	7	18
β-strand	208	1	19
β-strand	215-223	9	18
β-strand	231-242	12	20
β-strand	250	1	20
β-strand	253-259	7	20
β-strand	267-275	9	18
β-strand	289-291	3	17
β-strand	301	1	17
α-helix	302-303	2
β-strand	318-329	12	20
β-strand	337-341	5	20
β-strand	343	1	19

Chain H: 1 helix, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	20-28	9	1
β-strand	35-42	8	2
β-strand	49-55	7	2
β-strand	60-63	4	2
β-strand	68	1	1
β-strand	71-76	6	1
β-strand	81-87	7	1
β-strand	95-103	9	2
β-strand	121-122	2	2
β-strand	126-128	3	2
β-strand	136	1	3
β-strand	139-143	5	4
β-strand	155-164	10	4
β-strand	165	1	3
β-strand	172-173	2	5
β-strand	183-184	2	4
β-strand	188-189	2	4
β-strand	195-203	9	4
α-helix	205-207	3
β-strand	213-219	7	5
β-strand	224-230	7	5

Chain L: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	6
β-strand	11-12	2	7
β-strand	20-25	6	6
β-strand	35-39	5	8
β-strand	47	1	8
β-strand	49-50	2	9
β-strand	54-55	2	9
β-strand	63-66	4	6
β-strand	71-76	6	6
β-strand	86-91	6	8
β-strand	98-99	2	8
β-strand	104-105	2	7
β-strand	112	1	10
β-strand	115-119	5	11
α-helix	120-122	3
α-helix	123-128	6
β-strand	130-140	11	11
β-strand	141	1	10
β-strand	145-150	6	12
β-strand	160-162	3	11
α-helix	166-168	3
β-strand	174-183	10	11
α-helix	184-189	6
β-strand	192-199	8	12
β-strand	206-211	6	12

Chain R: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	353-355	3	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab7 heavy chain	H	protein	240	synthetic construct
Fab7 light chain	L	protein	215	synthetic construct
Atypical chemokine receptor 3	R	protein	393	Homo sapiens	P25106 (AlphaFold model)
Beta-arrestin-2	A	protein	392	Bos taurus	P32120 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>8TIL_1 Fab7 heavy chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVSSSYIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARKSMYHRGWGWLSWVYGAMD
YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Sequence of entity 2 (L), FASTA

>8TIL_2 Fab7 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYYYPITFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (R), FASTA

>8TIL_3 Atypical chemokine receptor 3 (chains R)
GAPDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIG
MIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCK
VTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLP
DTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARA
ISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALH
VTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALE
QSTKGRPLEVLFQGPHHHHHHHHHHDYKDDDDK

Sequence of entity 4 (A), FASTA

>8TIL_4 Beta-arrestin-2 (chains A)
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQVEQDDQVSPSSTFCKVYTITPLLSNNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS
AVPETDAPVDTNLIEFETNYATDDDIVFEDFA

Primary citation

Effect of phosphorylation barcodes on arrestin binding to a chemokine receptor. Chen, Q., Schafer, C.T., Mukherjee, S. et al. Nature (2025) 643:280-287. DOI 10.1038/s41586-025-09024-9 · PubMed

Other PDB entries of the same protein (UniProt P25106 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6K3F 2.3 Å, Crystal Structure of beta-Arrestin 2 in Complex with CXCR7 Phosphopeptide
8TII 3.0 Å, Human ACKR3 phosphorylated by GRK2 in complex with Arrestin2 in nanodisc
7SK4 3.3 Å, Cryo-EM structure of ACKR3 in complex with chemokine N-terminal mutant CXCL12_LRHQ, an…
7SK7 3.3 Å, Cryo-EM structure of human ACKR3 in complex with CXCL12, a small molecule partial…
7SK8 3.3 Å, Cryo-EM structure of human ACKR3 in complex with CXCL12, a small molecule partial…
8VJ9 3.3 Å, CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant…
9E82 3.4 Å, ACKR3 phosphorylated by GRK5 in complex with arrestin2 and Fab7
8TIO 3.6 Å, Human ACKR3 with C tail extended by 12 glycines phosphorylated by GRK5 in complex with…
7SK9 3.7 Å, Cryo-EM structure of human ACKR3 in complex with a small molecule partial agonist…
7SK3 3.8 Å, Cryo-EM structure of ACKR3 in complex with CXCL12, an intracellular Fab, and an…
7SK5 4.0 Å, Cryo-EM structure of ACKR3 in complex with CXCL12 and an intracellular Fab
7SK6 4.0 Å, Cryo-EM structure of human ACKR3 in complex with chemokine N-terminal mutant CXCL12_LRHQ…

Browse structure collections

About this viewer

MolViewer shows 8TIL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.