9E82: ACKR3 phosphorylated by GRK5

ACKR3 phosphorylated by GRK5 in complex with arrestin2 and Fab7. Determined by electron microscopy at 3.4 Å resolution. Released 2 Apr 2025.

Method: Electron microscopy
Resolution: 3.4 Å
Organisms: Bos taurus, Homo sapiens, synthetic construct
Chains: 5
Atoms: 8,200
Mol. weight: 150.18 kDa
Ligands: CLR
Released: 2 Apr 2025

Explore 9E82 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9E82 contains 32 α-helices and 78 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	18-21	4	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
α-helix	35-36	2
β-strand	38-43	6	1
β-strand	53-62	10	4
β-strand	78-87	10	4
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-116	5	1
α-helix	119-120	2
β-strand	127-129	3	5
α-helix	130-132	3
α-helix	138-139	2
β-strand	141-150	10	4
β-strand	163-168	6	4
β-strand	169-171	3	2
α-helix	173-175	3
β-strand	184-188	5	6
α-helix	196	1
β-strand	197-201	5	6
β-strand	203	1	6
β-strand	208-209	2	7
β-strand	214-222	9	6
β-strand	228-230	3	8
β-strand	231-234	4	9
β-strand	237-242	6	10
β-strand	249-251	3	10
β-strand	255-258	4	9
β-strand	266-274	9	6
α-helix	278-280	3
β-strand	288-290	3	5
β-strand	300	1	5
α-helix	301-304	4
β-strand	316-327	12	10
β-strand	328-329	2	8
β-strand	343-349	7	10
β-strand	351-352	2	7

Chain H: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	11
β-strand	21-28	8	11
α-helix	32-34	3
β-strand	35-42	8	12
β-strand	50-55	6	12
β-strand	60-63	4	12
α-helix	65-67	3
β-strand	71	1	11
β-strand	74-76	3	11
β-strand	81-86	6	11
α-helix	91-93	3
β-strand	95-103	9	12
β-strand	105	1	13
β-strand	111	1	13
β-strand	121-122	2	12
β-strand	127-128	2	12
β-strand	136	1	14
β-strand	139-143	5	15
β-strand	155-164	10	15
β-strand	165	1	14
β-strand	170-173	4	16
β-strand	183-184	2	15
α-helix	185-187	3
β-strand	195-203	9	15
α-helix	205-207	3
β-strand	213-219	7	16
β-strand	224-230	7	16

Chain L: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	17
β-strand	8	1	18
β-strand	11-13	3	19
β-strand	20-25	6	18
β-strand	26	1	17
β-strand	34-36	3	20
β-strand	49-50	2	20
β-strand	54-55	2	20
α-helix	56	1
β-strand	63-66	4	18
β-strand	71-76	6	18
β-strand	89-91	3	20
β-strand	98-99	2	20
β-strand	104-106	3	19
β-strand	112	1	21
α-helix	113-114	2
β-strand	115-119	5	22
α-helix	120-122	3
α-helix	123-128	6
β-strand	130-140	11	22
β-strand	141	1	21
β-strand	145-150	6	23
β-strand	160-161	2	22
β-strand	164	1	22
α-helix	165-168	4
β-strand	174-183	10	22
α-helix	184-187	4
β-strand	192-199	8	23
β-strand	206-211	6	23

Chain R: 11 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	40-69	30
α-helix	81-105	25
α-helix	114-145	32
α-helix	158-181	24
β-strand	183-187	5	24
β-strand	194-198	5	24
α-helix	202-204	3
α-helix	208-214	7
α-helix	215-222	8
α-helix	223-238	16
α-helix	253-279	27
α-helix	287-310	24
α-helix	311-313	3
β-strand	339-342	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	418	Bos taurus	P17870 (AlphaFold model)
SDF-1-beta(3-72)	B	protein	69	Homo sapiens	P48061 (AlphaFold model)
Fab7 heavy chain	H	protein	240	synthetic construct
Fab7 light chain	L	protein	215	synthetic construct
Atypical chemokine receptor 3	R	protein	393	Homo sapiens	P25106 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9E82_1 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLIELDTNDDDAAAEDFARQRLKGMKDDKEEEEDGTGSPRLNDR

Sequence of entity 2 (B), FASTA

>9E82_2 SDF-1-beta(3-72) (chains B)
LRHQSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQ
EYLEKALNK

Sequence of entity 3 (H), FASTA

>9E82_3 Fab7 heavy chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVSSSYIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARKSMYHRGWGWLSWVYGAMD
YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Sequence of entity 4 (L), FASTA

>9E82_4 Fab7 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYYYPITFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 5 (R), FASTA

>9E82_5 Atypical chemokine receptor 3 (chains R)
GAPDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIG
MIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCK
VTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLP
DTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARA
ISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALH
VTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALE
QSTKGRPLEVLFQGPHHHHHHHHHHDYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
CLR	Cholesterol	C27 H46 O	1

Primary citation

Effect of phosphorylation barcodes on arrestin binding to a chemokine receptor. Chen, Q., Schafer, C.T., Mukherjee, S. et al. Nature (2025) 643:280-287. DOI 10.1038/s41586-025-09024-9 · PubMed

Other PDB entries of the same protein (UniProt P17870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G4M 1.9 Å, Crystal structure of bovine beta-arrestin 1
1G4R 2.2 Å, Crystal structure of bovine beta-arrestin 1
3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex
22GK 2.84 Å, C5a bound C5aR2 in complex with beta-arrestin1
1JSY 2.9 Å, Crystal structure of bovine arrestin-2
1ZSH 2.9 Å, Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6)
22CR 2.9 Å, C5a-desArg bound C5aR2 in complex with beta-arrestin1

Browse structure collections

About this viewer

MolViewer shows 9E82 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.