8TIM: Triose phosphate isomerase

Name: PDB 8TIM: Triose phosphate isomerase
Published: 1999-02-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: isomerase

Triose phosphate isomerase. Determined by X-ray diffraction at 2.5 Å resolution. Released 16 Feb 1999.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Gallus gallus
Chains: 2
Atoms: 3,778
Mol. weight: 53.27 kDa
Released: 16 Feb 1999

Explore 8TIM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TIM contains 31 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	1
β-strand	14	1	2
α-helix	18-30	13
β-strand	37-43	7	1
α-helix	45-47	3
α-helix	48-54	7
β-strand	60-63	4	1
β-strand	72	1	3
α-helix	80-86	7
β-strand	90-93	4	1
α-helix	96-100	5
α-helix	106-118	13
β-strand	122-127	6	1
α-helix	131-136	6
α-helix	139-151	13
α-helix	157-159	3
β-strand	160-164	5	1
α-helix	167-170	4
α-helix	178-195	18
α-helix	198-203	6
β-strand	206-208	3	1
α-helix	217-222	6
β-strand	228-231	4	1
α-helix	233-236	4
α-helix	239-244	6

Chain B: 16 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
β-strand	6-11	6	4
β-strand	14	1	3
α-helix	18-29	12
β-strand	37-43	7	4
α-helix	45-47	3
α-helix	48-54	7
β-strand	60-63	4	4
β-strand	72	1	2
α-helix	80-86	7
β-strand	90-93	4	4
α-helix	96-100	5
α-helix	106-118	13
β-strand	122-127	6	4
α-helix	131-136	6
α-helix	139-151	13
α-helix	157-159	3
β-strand	160-164	5	4
α-helix	167-169	3
α-helix	178-195	18
α-helix	198-203	6
β-strand	206-208	3	4
α-helix	217-222	6
β-strand	228-231	4	4
α-helix	233-236	4
α-helix	239-244	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Triose phosphate isomerase	A, B	protein	247	Gallus gallus	P00940 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8TIM_1 TRIOSE PHOSPHATE ISOMERASE (chains A, B)
APRKFFVGGNWKMNGDKKSLGELIHTLNGAKLSADTEVVCGAPSIYLDFARQKLDAKIGV
AAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEGL
GVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQQA
QEVHEKLRGWLKTHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKPEFV
DIINAKH

Primary citation

Triose Phosphate Isomerase. Artymiuk, P.J., Taylor, W.R., Phillips, D.C. To be published.

Other PDB entries of the same protein (UniProt P00940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4P61 1.34 Å, Chicken triosephosphate isomerase with LOOP6 mutations, V167P and W168E.
1SW0 1.71 Å, Triosephosphate isomerase from Gallus gallus, loop 6 hinge mutant K174L, T175W
1TPH 1.8 Å, 1.8 Å crystal structure of wild type chicken triosephosphate…
1TPB 1.9 Å, Offset of a catalytic lesion by a bound water soluble
1TPC 1.9 Å, Offset of a catalytic lesion by a bound water soluble
1TPU 1.9 Å, S96P change is a second-site suppressor for H95N sluggish mutant triosephosphate isomerase
1TPV 1.9 Å, S96P change is a second-site suppressor for H95N sluggish mutant triosephosphate isomerase
1TPW 1.9 Å, Triosephosphate isomerase drinks water to keep healthy
1SW3 2.03 Å, Triosephosphate isomerase from Gallus gallus, loop 6 mutant T175V
1SPQ 2.16 Å, Understanding protein lids: Structural analysis of active hinge mutants in…
1SW7 2.22 Å, Triosephosphate isomerase from Gallus gallus, loop 6 mutant K174N, T175S, A176S
1TIM 2.5 Å, Structure of triose phosphate isomerase from chicken muscle

Browse structure collections

About this viewer

MolViewer shows 8TIM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.