8TLO: Crystal Structure Analysis of BCL11A

Crystal Structure Analysis of BCL11A in complex with DNA. Determined by X-ray diffraction at 2.76 Å resolution. Released 14 Aug 2024.

Method: X-ray diffraction
Resolution: 2.76 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,445
Mol. weight: 24.6 kDa
Ligands: ZN
Released: 14 Aug 2024

Explore 8TLO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TLO contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	743	1	1
β-strand	750	1	1
α-helix	754-765	12
β-strand	770-771	2	2
β-strand	778-779	2	2
α-helix	782-789	8
α-helix	790-792	3
α-helix	798-799	2
β-strand	800-801	2	3
β-strand	808-809	2	3
α-helix	812-814	3
α-helix	815-822	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell lymphoma/leukemia 11A	A	protein	110	Homo sapiens	Q9H165 (AlphaFold model)
DNA (5'-d(pcpgpapcpcpgpcpaptptpgpgptpcpapapgpcp*g)-3')	B	DNA	19	Homo sapiens
DNA (5'-d(pgpcptptpgpapcpcpapaptpgpcpgpgptpcpgp*c)-3')	C	DNA	19	Homo sapiens

Sequence of entity 1 (A), FASTA

>8TLO_1 B-cell lymphoma/leukemia 11A (chains A)
GPHMPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKL
TRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE

Sequence of entity 2 (B), FASTA

>8TLO_2 DNA (5'-D(P*CP*GP*AP*CP*CP*GP*CP*AP*TP*TP*GP*GP*TP*CP*AP*AP*GP*CP*G)-3') (chains B)
CGACCGCATTGGTCAAGCG

Sequence of entity 3 (C), FASTA

>8TLO_3 DNA (5'-D(P*GP*CP*TP*TP*GP*AP*CP*CP*AP*AP*TP*GP*CP*GP*GP*TP*CP*GP*C)-3') (chains C)
GCTTGACCAATGCGGTCGC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Structural insights into the DNA-binding mechanism of BCL11A: The integral role of ZnF6. Viennet, T., Yin, M., Jayaraj, A. et al. Structure (2024) 32:2276-2286.e4. DOI 10.1016/j.str.2024.09.022 · PubMed

Other PDB entries of the same protein (UniProt Q9H165 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6U9Q 1.83 Å, Crystal Structure Analysis of DNA-BCL11A Znf domain complex
9YLM 1.91 Å, BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus…
9YLO 1.97 Å, BCL11A ZF2-3 in Complex with a DNA Sequence Observed in the Human Globin Locus…
9YLP 2.04 Å, BCL11A ZF2-3 in Complex with a DNA Sequence Observed in the Human Globin Locus…
9E6R 2.09 Å, BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus…
9YLN 2.15 Å, BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus…
8DTN 2.2 Å, The complex of nanobody 6101 with BCL11A ZF6
9E6S 2.2 Å, BCL11A ZF4-6 with K784T Mutation in Complex with a DNA Sequence Observed in the Human…
9YLL 2.38 Å, BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus…
5VTB 2.4 Å, Crystal structure of RBBP4 bound to BCL11a peptide
8DTU 2.45 Å, The complex of nanobody 5344N74D with BCL11A ZF6.
6KI6 2.5 Å, Crystal structure of BCL11A in complex with gamma-globin -115 HPFH region

Browse structure collections

About this viewer

MolViewer shows 8TLO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.