8TLV: MBP and AF9 AHD fusion protein 4AQK

Crystal structure of MBP and AF9 AHD fusion protein 4AQK in complex with peptidomimetic inhibitor 28. Determined by X-ray diffraction at 2.66 Å resolution. Released 29 May 2024.

Method: X-ray diffraction
Resolution: 2.66 Å
Organisms: Escherichia coli K-12, Homo sapiens, synthetic construct
Chains: 2
Atoms: 3,444
Mol. weight: 50.37 kDa
Ligands: GSH
Released: 29 May 2024

Explore 8TLV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TLV contains 26 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
α-helix	18-32	15
β-strand	35-39	5	1
α-helix	44-52	9
β-strand	60-64	5	1
α-helix	65-67	3
α-helix	68-73	6
β-strand	77	1	2
α-helix	78-80	3
α-helix	84-87	4
β-strand	90	1	3
α-helix	92-97	6
β-strand	99-100	2	4
β-strand	103-104	2	4
β-strand	107-112	6	1
β-strand	115-119	5	5
β-strand	129	1	6
α-helix	130-132	3
α-helix	133-142	10
β-strand	146-148	3	5
α-helix	155-164	10
β-strand	168-171	4	7
β-strand	178-183	6	7
α-helix	187-201	15
α-helix	211-219	9
β-strand	223-228	6	5
α-helix	230-232	3
α-helix	233-239	7
β-strand	243-246	4	5
α-helix	247-249	3
β-strand	250-251	2	6
β-strand	254-255	2	6
α-helix	256	1
β-strand	259-260	2	8
β-strand	261-267	7	1
β-strand	268	1	2
α-helix	274-280	7
α-helix	281-285	5
α-helix	288-297	10
β-strand	302-303	2	1
β-strand	305	1	3
α-helix	306-312	7
α-helix	316-327	12
β-strand	329-330	2	8
α-helix	331-332	2
α-helix	337-352	16
α-helix	358-516	31
α-helix	520-533	14
β-strand	537-538	2	9
β-strand	543-545	3	9
α-helix	552-560	9

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-4	2	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MBP and AF9 AHD fusion protein 4AQK	A	protein	443	Escherichia coli K-12, Homo sapiens	P0AEX9 (AlphaFold model), P42568 (AlphaFold model)
peptidomimetic inhibitor 28	B	protein	6	synthetic construct

Sequence of entity 1 (A), FASTA

>8TLV_1 MBP and AF9 AHD fusion protein 4AQK (chains A)
SGGSKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDG
PDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLI
YNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKY
DIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNID
TSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKD
KPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPCMSAFWYAVRTAVINAASGRQT
VDEALKDAQTAAAADCAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDF
DLCSLDKTTVRKLQSYLETSGTS

Sequence of entity 2 (B), FASTA

>8TLV_2 peptidomimetic inhibitor 28 (chains B)
XPVAXX

Ligands and cofactors

ID	Name	Formula	Copies
GSH	Glutathione	C10 H17 N3 O6 S	1

Primary citation

Structural studies of intrinsically disordered MLL-fusion protein AF9 in complex with peptidomimetic inhibitors. Yang, Y., Ahmad, E., Premkumar, V. et al. Protein Sci (2024) 33:e5019-e5019. DOI 10.1002/pro.5019 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 8TLV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.