8TVY: DNA-directed RNA polymerase II subunit RPB1

Cryo-EM structure of CPD lesion containing RNA Polymerase II elongation complex with Rad26 and Elf1 (closed state). Determined by electron microscopy at 3.1 Å resolution. Released 24 Jan 2024.

Method: Electron microscopy
Resolution: 3.1 Å
Organisms: Saccharomyces cerevisiae, synthetic construct
Chains: 17
Atoms: 39,536
Mol. weight: 681.08 kDa
Ligands: ZN, MG
Released: 24 Jan 2024

Explore 8TVY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TVY contains 222 α-helices and 261 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 76 helices, 79 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	16-18	3	2
β-strand	21	1	3
α-helix	24-30	7
β-strand	34	1	4
β-strand	41	1	5
β-strand	49	1	5
β-strand	61	1	6
β-strand	64	1	6
α-helix	74-76	3
β-strand	82-91	10	4
α-helix	93-95	3
α-helix	96-104	9
α-helix	120-127	8
α-helix	131-143	13
β-strand	147	1	7
β-strand	151-153	3	8
α-helix	154	1
β-strand	161-163	3	8
β-strand	170	1	7
β-strand	175-177	3	9
β-strand	180-182	3	9
β-strand	189	1	10
β-strand	194	1	10
β-strand	201	1	9
α-helix	204-213	10
α-helix	216-222	7
β-strand	225	1	11
β-strand	229	1	11
α-helix	231-234	4
β-strand	235-241	7	4
α-helix	244-246	3
α-helix	261-281	21
α-helix	286-304	19
β-strand	315	1	12
β-strand	321	1	12
α-helix	325-328	4
β-strand	343-345	3	13
β-strand	348-352	5	14
β-strand	353-355	3	15
β-strand	363	1	14
β-strand	365	1	15
β-strand	366-367	2	16
α-helix	368-371	4
β-strand	375-379	5	17
α-helix	380	1
α-helix	385-394	10
α-helix	395-397	3
β-strand	402-406	5	17
β-strand	412-414	3	17
α-helix	415-417	3
α-helix	419-422	4
β-strand	431-435	5	17
α-helix	436	1
β-strand	441-445	5	14
α-helix	452-454	3
β-strand	455-459	5	14
β-strand	462-463	2	16
β-strand	468-470	3	15
α-helix	475-478	4
β-strand	486-490	5	14
α-helix	495-504	10
β-strand	506	1	14
α-helix	507-510	4
β-strand	512	1	18
β-strand	519	1	18
α-helix	525-534	10
β-strand	540-541	2	19
α-helix	543-551	9
α-helix	560-563	4
β-strand	565	1	20
β-strand	571	1	20
β-strand	572-573	2	19
α-helix	574-579	6
α-helix	583	1
β-strand	588-591	4	21
β-strand	604-607	4	21
β-strand	612-614	3	21
α-helix	629-636	8
α-helix	639-660	22
β-strand	662-663	2	22
α-helix	666-669	4
α-helix	673-698	26
α-helix	702-705	4
α-helix	710-736	27
α-helix	742-749	8
α-helix	755-762	8
β-strand	769-770	2	23
β-strand	773-774	2	23
α-helix	775-776	2
α-helix	794-797	4
α-helix	810-844	35
β-strand	849-850	2	24
β-strand	856-857	2	24
β-strand	863-865	3	24
α-helix	868-870	3
β-strand	873	1	25
α-helix	875-877	3
β-strand	879-882	4	26
α-helix	890-897	8
β-strand	900	1	27
β-strand	907	1	27
α-helix	908-909	2
α-helix	910-912	3
β-strand	913	1	28
α-helix	916-919	4
α-helix	923-946	24
β-strand	953-956	4	26
α-helix	960-971	12
α-helix	978	1
β-strand	979	1	28
α-helix	983-995	13
α-helix	1005-1014	10
α-helix	1016-1025	10
α-helix	1028-1029	2
α-helix	1030-1034	5
α-helix	1039-1056	18
β-strand	1057	1	25
α-helix	1058-1059	2
α-helix	1064-1076	13
α-helix	1097-1105	9
β-strand	1116-1117	2	29
β-strand	1118-1119	2	30
β-strand	1120	1	31
α-helix	1121	1
α-helix	1122-1125	4
α-helix	1129-1138	10
β-strand	1141-1142	2	32
α-helix	1143-1145	3
β-strand	1147-1154	8	33
α-helix	1164-1174	11
β-strand	1191-1197	7	33
α-helix	1199-1204	6
α-helix	1209-1219	11
β-strand	1224-1227	4	33
β-strand	1237-1242	6	33
α-helix	1257-1270	14
β-strand	1272-1274	3	32
β-strand	1283-1292	10	30
β-strand	1298-1307	10	30
α-helix	1313-1316	4
β-strand	1322	1	31
β-strand	1328-1329	2	29
α-helix	1332-1339	8
α-helix	1341-1357	17
α-helix	1365-1375	11
β-strand	1378	1	34
α-helix	1396-1400	5
α-helix	1405-1415	11
β-strand	1418-1419	2	2
α-helix	1424-1430	7
α-helix	1437-1439	3
β-strand	1441-1442	2	35
β-strand	1444	1	36
α-helix	1447-1450	4

Chain B: 53 helices, 73 β-strands

Element	Residues	Length	Sheet
α-helix	30-40	11
α-helix	45-53	9
α-helix	54-58	5
α-helix	59-64	6
β-strand	69-77	9	37
β-strand	84-97	14	37
β-strand	101-103	3	38
β-strand	109-111	3	38
α-helix	114-120	7
β-strand	125-137	13	37
α-helix	145-148	4
α-helix	150-155	6
β-strand	157-160	4	37
β-strand	164-171	8	37
α-helix	186-189	4
β-strand	203-205	3	39
β-strand	208-212	5	39
β-strand	214-218	5	40
α-helix	219	1
β-strand	224-227	4	41
α-helix	228-229	2
β-strand	234-240	7	41
β-strand	254-259	6	41
α-helix	265-267	3
β-strand	269-272	4	41
β-strand	280-281	2	41
α-helix	282-288	7
α-helix	296-301	6
α-helix	308-321	14
α-helix	327-338	12
α-helix	349-358	10
α-helix	370-389	20
α-helix	394-397	4
α-helix	401-403	3
β-strand	404-407	4	40
α-helix	409-434	26
α-helix	438-463	26
β-strand	480-482	3	39
α-helix	483-484	2
α-helix	488-494	7
β-strand	497	1	42
β-strand	498-499	2	40
α-helix	501-505	5
α-helix	516-518	3
β-strand	522	1	43
α-helix	530-532	3
β-strand	533	1	44
β-strand	536	1	44
β-strand	538	1	42
β-strand	539	1	43
β-strand	544-545	2	45
α-helix	552-560	9
β-strand	564	1	46
α-helix	566-568	3
β-strand	580-582	3	47
β-strand	585-586	2	47
β-strand	589	1	46
α-helix	593-606	14
β-strand	614-618	5	47
β-strand	623-627	5	47
β-strand	633-639	7	45
β-strand	640-641	2	48
β-strand	650-651	2	48
α-helix	655-669	15
α-helix	681-687	7
β-strand	690-694	5	45
α-helix	697-699	3
β-strand	703-704	2	45
α-helix	707-710	4
α-helix	712-716	5
β-strand	740-741	2	45
α-helix	753-755	3
α-helix	764-773	10
β-strand	793-796	4	49
β-strand	800	1	50
β-strand	804-805	2	51
α-helix	809-812	4
β-strand	821-827	7	52
β-strand	828-829	2	22
β-strand	839-842	4	52
α-helix	843-846	4
β-strand	853-862	10	49
β-strand	873-874	2	53
β-strand	883	1	53
β-strand	898	1	54
α-helix	899-900	2
β-strand	904-906	3	49
β-strand	910-912	3	54
β-strand	914-917	4	53
α-helix	923-927	5
β-strand	934-936	3	53
β-strand	939-940	2	54
α-helix	941-942	2
β-strand	946-956	11	49
β-strand	962-972	11	49
β-strand	979-982	4	52
β-strand	987-994	8	52
α-helix	996-998	3
β-strand	1001-1002	2	52
β-strand	1010-1012	3	52
α-helix	1016-1020	5
α-helix	1023-1038	16
β-strand	1042-1043	2	51
α-helix	1052-1061	10
β-strand	1069-1073	5	52
α-helix	1079	1
β-strand	1080-1094	15	52
α-helix	1099-1101	3
β-strand	1104-1106	3	14
β-strand	1111	1	55
β-strand	1118	1	55
α-helix	1119	1
α-helix	1126-1127	2
β-strand	1128-1130	3	13
α-helix	1132-1141	10
α-helix	1144-1148	5
α-helix	1149-1156	8
β-strand	1159-1163	5	1
β-strand	1174	1	56
β-strand	1179	1	56
β-strand	1182	1	57
β-strand	1187	1	57
β-strand	1191-1195	5	1
α-helix	1198-1209	12
β-strand	1212	1	3
β-strand	1215-1217	3	2

Chain C: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	58
β-strand	17-23	7	58
α-helix	27-39	13
β-strand	43-54	12	59
α-helix	60-68	9
β-strand	72-74	3	60
α-helix	77-79	3
α-helix	83-85	3
β-strand	97-100	4	59
β-strand	102-104	3	59
α-helix	110	1
β-strand	111-114	4	61
α-helix	115-117	3
β-strand	119-120	2	59
β-strand	129-132	4	60
β-strand	143-147	5	61
β-strand	152-162	11	59
α-helix	168-170	3
β-strand	173-179	7	58
α-helix	197-200	4
α-helix	202-204	3
α-helix	205-209	5
α-helix	211-214	4
β-strand	228-234	7	58
α-helix	240-269	30

Chain D: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
β-strand	24	1	62
β-strand	36-38	3	63
β-strand	44-46	3	63
β-strand	48-49	2	36
α-helix	52-66	15
α-helix	122-133	12
α-helix	139-150	12
α-helix	157-170	14
α-helix	174-182	9
α-helix	188-194	7
α-helix	196-199	4
α-helix	204-220	17

Chain E: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-25	20
β-strand	28	1	64
α-helix	32-35	4
α-helix	39-45	7
α-helix	55-58	4
β-strand	60-62	3	65
β-strand	64	1	64
α-helix	66-71	6
β-strand	78-82	5	65
β-strand	87-88	2	66
α-helix	90-103	14
β-strand	107-112	6	65
β-strand	115-116	2	66
α-helix	118-121	4
α-helix	124-126	3
β-strand	131-136	6	65
α-helix	137-140	4
α-helix	144-146	3
β-strand	152-155	4	34
α-helix	156-157	2
α-helix	158-168	11
β-strand	177-178	2	34
α-helix	183-188	6
α-helix	190-191	2
β-strand	195-200	6	34
β-strand	208-214	7	34

Chain F: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	84	1	67
α-helix	85-86	2
α-helix	87-102	16
α-helix	117-126	10
β-strand	133-137	5	35
β-strand	143-147	5	35
β-strand	152	1	67

Chain G: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	36
α-helix	15-17	3
α-helix	22-34	13
β-strand	38-39	2	36
β-strand	43-48	6	36
β-strand	55	1	36
β-strand	60-61	2	36
β-strand	68-79	12	36
β-strand	83	1	62
β-strand	85-95	11	68
β-strand	98-103	6	68
β-strand	106-110	5	68
α-helix	112-114	3
β-strand	122	1	69
β-strand	129	1	69
β-strand	130	1	70
β-strand	137	1	70
β-strand	142-147	6	68
β-strand	149-152	4	68
β-strand	157-161	5	68
α-helix	166-168	3
β-strand	170	1	68

Chain H: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-16	13	20
β-strand	23-30	8	20
β-strand	37-43	7	20
β-strand	54-60	7	20
α-helix	72-74	3
α-helix	82-86	5
β-strand	95-99	5	20
β-strand	100	1	71
β-strand	107	1	72
β-strand	111	1	72
β-strand	112-114	3	20
α-helix	115	1
β-strand	117	1	71
β-strand	118	1	73
β-strand	121	1	73
β-strand	125-127	3	20
β-strand	140-144	5	20

6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase II subunit RPB1	A	protein	1733	Saccharomyces cerevisiae	P04050 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	B	protein	1224	Saccharomyces cerevisiae	P08518 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	318	Saccharomyces cerevisiae	P16370 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB4	D	protein	221	Saccharomyces cerevisiae	P20433 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III subunit RPABC1	E	protein	215	Saccharomyces cerevisiae	P20434
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F	protein	155	Saccharomyces cerevisiae	P20435
DNA-directed RNA polymerase II subunit RPB7	G	protein	171	Saccharomyces cerevisiae	P34087
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	146	Saccharomyces cerevisiae	P20436
DNA-directed RNA polymerase II subunit RPB9	I	protein	122	Saccharomyces cerevisiae	P27999
DNA-directed RNA polymerases II subunit RPABC5	J	protein	70	Saccharomyces cerevisiae	P22139
DNA-directed RNA polymerase II subunit RPB11	K	protein	120	Saccharomyces cerevisiae	P38902
DNA-directed RNA polymerases II subunit RPABC4	L	protein	70	Saccharomyces cerevisiae	P40422

5 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>8TVY_1 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGS
IDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNE
LMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLK
LVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHV
ATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLE
LDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKR
AGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTF
IELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSP
KDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHN
GFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFV
DRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRR
LVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVD
LLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCC
LLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMT
LNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEH
TTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHML
KKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVP
GIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGG
LTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGS
NDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTS
PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYS
PTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Sequence of entity 2 (B), FASTA

>8TVY_2 DNA-directed RNA polymerase subunit beta (chains B)
MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQ
DIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLR
NLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCY
LSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEH
ICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEF
LPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTL
FKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLS
LMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETL
RTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAK
LMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGV
FLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMI
MNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIA
PGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSR
MTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKK
LMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIA
HGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF

Sequence of entity 3 (C), FASTA

>8TVY_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI
VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY
SNASQMGNTGSGGYDNAW

Sequence of entity 4 (D), FASTA

>8TVY_4 DNA-directed RNA polymerase II subunit RPB4 (chains D)
MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIK
EALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETRE
KELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQL
GSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY

Sequence of entity 5 (E), FASTA

>8TVY_5 DNA-directed RNA polymerases I, II, and III subunit RPABC1 (chains E)
MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSF
QANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSA
MKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQR
ADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Sequence of entity 6 (F), FASTA

>8TVY_6 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQ
HEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRI
AMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Sequence of entity 7 (G), FASTA

>8TVY_7 DNA-directed RNA polymerase II subunit RPB7 (chains G)
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGR
ILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLT
FNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI

Sequence of entity 8 (H), FASTA

>8TVY_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA
SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGG
LLMRLEGNYRNLNNLKQENAYLLIRR

Sequence of entity 9 (I), FASTA

>8TVY_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQ
DIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
FS

Sequence of entity 10 (J), FASTA

>8TVY_10 DNA-directed RNA polymerases II subunit RPABC5 (chains J)
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKF
LRYNPLEKRD

Sequence of entity 11 (K), FASTA

>8TVY_11 DNA-directed RNA polymerase II subunit RPB11 (chains K)
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA
YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

Sequence of entity 12 (L), FASTA

>8TVY_12 DNA-directed RNA polymerases II subunit RPABC4 (chains L)
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKAR
TKRLVQFEAR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8
MG	Magnesium ion	Mg	1

Primary citation

Elf1 promotes Rad26's interaction with lesion-arrested Pol II for transcription-coupled repair. Sarsam, R.D., Xu, J., Lahiri, I. et al. Proc Natl Acad Sci U S A (2024) 121:e2314245121-e2314245121. DOI 10.1073/pnas.2314245121 · PubMed

Other PDB entries of the same protein (UniProt P04050 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VKO 1.8 Å, SPT6 tSH2-RPB1 1468-1500 pT1471, pS1493
9SV6 1.96 Å, CryoEM structure of transcribing RNA polymerase II elongation complex with ATP and Elf1
5VKL 2.2 Å, SPT6 tSH2-RPB1 1476-1500 pS1493
9W8V 2.23 Å, Structure of post-translocation state of yeast Pol II complexed with a cisplatin-induced…
9QEB 2.26 Å, CryoEM structure of transcribing RNA polymerase II elongation complex
1TWF 2.3 Å, RNA polymerase II complexed with UTP at 2.3 A resolution
9RYB 2.33 Å, CryoEM structure of transcribing RNA polymerase II elongation complex in post-catalysis…
9KD8 2.46 Å, The structure of RNA polymerase II elongation complex paused at N-2 state by actinomycin…
6NPW 2.49 Å, SSu72/Sympk in complex with Ser2/Ser5 phosphorylated peptide
9K7F 2.5 Å, RNA polymerase II elongation complex apo structure.
30ES 2.54 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…
30EP 2.55 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…

Browse structure collections

About this viewer

MolViewer shows 8TVY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.