8U87: Human NOX5 Activation

Structural Basis of Human NOX5 Activation. Determined by electron microscopy at 3.86 Å resolution. Released 1 May 2024.

Method: Electron microscopy
Resolution: 3.86 Å
Organism: Homo sapiens
Chains: 2
Atoms: 8,575
Mol. weight: 170.01 kDa
Ligands: D12, ZN, FAD, NDP
Released: 1 May 2024

Explore 8U87 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8U87 contains 52 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	10-18	9
β-strand	27-28	2	1
α-helix	29-36	8
α-helix	42-51	10
β-strand	58-59	2	1
α-helix	61-71	11
α-helix	76-87	12
α-helix	97-111	15
α-helix	117-131	15
α-helix	141-148	8
α-helix	154-157	4
α-helix	161-165	5
α-helix	183-186	4
α-helix	192-213	22
α-helix	221-240	20
α-helix	246-252	7
α-helix	255-258	4
α-helix	264-293	30
α-helix	321-337	17
α-helix	342-345	4
α-helix	349-355	7
α-helix	356-358	3
α-helix	359-367	9
α-helix	373-390	18
β-strand	398-401	4	2
β-strand	402-408	7	3
β-strand	412-418	7	3
α-helix	419-420	2
β-strand	430-433	4	4
β-strand	444-447	4	4
β-strand	457-463	7	3
α-helix	468-477	10
β-strand	518-521	4	2
α-helix	530-533	4
β-strand	538-543	6	5
α-helix	548-562	15
β-strand	565-567	3	6
β-strand	574-576	3	6
β-strand	588-594	7	5
α-helix	601-615	15
β-strand	624-630	7	5
α-helix	634-635	2
α-helix	639-655	17
β-strand	658	1	7
β-strand	663	1	7
α-helix	674-683	10
β-strand	690-694	5	5
α-helix	697-710	14

Chain C: 21 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	183-188	6
α-helix	190-212	23
α-helix	221-241	21
α-helix	245-252	8
α-helix	255-258	4
α-helix	264-292	29
α-helix	321-337	17
α-helix	341-345	5
α-helix	350-355	6
α-helix	356-358	3
α-helix	359-367	9
α-helix	373-390	18
β-strand	397-398	2	8
β-strand	401	1	9
β-strand	402-407	6	10
α-helix	409-411	3
β-strand	413-418	6	10
α-helix	419-420	2
β-strand	430-433	4	11
β-strand	444-447	4	11
β-strand	448	1	10
β-strand	457-462	6	10
α-helix	468-476	9
β-strand	518	1	9
β-strand	521-522	2	8
β-strand	525	1	11
α-helix	530-533	4
β-strand	538-543	6	12
α-helix	548-562	15
β-strand	565-567	3	13
β-strand	574-576	3	13
β-strand	588-593	6	12
α-helix	601-613	13
α-helix	616-619	4
β-strand	624	1	12
β-strand	627-629	3	12
β-strand	668	1	12
α-helix	674-683	10
β-strand	690-691	2	14
β-strand	692-694	3	12
α-helix	697-709	13
β-strand	713-714	2	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NADPH oxidase 5	A, C	protein	719	Homo sapiens	Q96PH1 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>8U87_1 NADPH oxidase 5 (chains A, C)
MSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESFFAERFFALFDSDRSGTIT
LQELQEALTLLIHGSPMDKLKFLFQVYDIDGSGSIDPDELRTVLQSCLRESAISLPDEKL
DQLTLALFESADADGNGAITFEELRDELQRFPGVMENLTISAAHWLTAPAPRPRPRRPRQ
LTRAYWHNHRSQLFCLATYAGLHVLLFGLAASAHRDLGASVMVAKGCGQCLNFDCSFIAV
LMLRRCLTWLRATWLAQVLPLDQNIQFHQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASP
FQFWELLLTTRPGIGWVHGSASPTGVALLLLLLLMFICSSSCIRRSGHFEVFYWTHLSYL
LVWLLLIFHGPNFWKWLLVPGILFFLEKAIGLAVSRMAAVCIMEVNLLPSKVTHLLIKRP
PFFHYRPGDYLYLNIPTIARYEWHPFTISSAPEQKDTIWLHIRSQGQWTNRLYESFKASD
PLGRGSKRLSRSVTMRKSQRSSKGSEILLEKHKFCNIKCYIDGPYGTPTRRIFASEHAVL
IGAGIGITPFASILQSIMYRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSF
EWFVSLLTKLEMDQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSI
TGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF

Ligands and cofactors

ID	Name	Formula	Copies
D12	Dodecane	C12 H26	1
ZN	Zinc ion	Zn	1
FAD	Flavin-adenine dinucleotide	C27 H33 N9 O15 P2	2
NDP	NADPH dihydro-nicotinamide-adenine-dinucleotide phosphate	C21 H30 N7 O17 P3	2
HEB	Heme b/c	C34 H34 Fe N4 O4	4

Primary citation

Structural basis of human NOX5 activation. Cui, C., Jiang, M., Jain, N. et al. Nat Commun (2024) 15:3994-3994. DOI 10.1038/s41467-024-48467-y · PubMed

Other PDB entries of the same protein (UniProt Q96PH1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SZ5 2.23 Å, Human calmodulin bound to a peptide of human NADPH oxidase 5
8U85 3.2 Å, Structural Basis of Human NOX5 Activation
8U86 3.3 Å, Structural Basis of Human NOX5 Activation
8U7Y 4.06 Å, Structural Basis of Human NOX5 Activation

Browse structure collections

About this viewer

MolViewer shows 8U87 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.