8UBV: F-box/LRR-repeat protein 17

Name: PDB 8UBV: Cryo-EM structure of dimeric FBXL17-BACH1BTB E3 ubiquitin ligase complex
Published: 2024-11-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Cryo-EM structure of dimeric FBXL17-BACH1BTB E3 ubiquitin ligase complex. Determined by electron microscopy at 4.1 Å resolution. Released 6 Nov 2024.

Method: Electron microscopy
Resolution: 4.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,603
Mol. weight: 116.69 kDa
Released: 6 Nov 2024

Explore 8UBV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8UBV contains 36 α-helices and 47 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 14 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	371	1	1
α-helix	378-381	4
β-strand	392	1	2
β-strand	396	1	1
α-helix	401-408	8
β-strand	416	1	3
β-strand	418	1	2
β-strand	419	1	4
α-helix	427-435	9
β-strand	442	1	3
β-strand	445	1	4
α-helix	454-462	9
β-strand	468	1	5
α-helix	480-487	8
β-strand	494	1	5
β-strand	497	1	6
α-helix	506-509	4
β-strand	520	1	5
β-strand	523	1	6
α-helix	530-533	4
α-helix	534-537	4
β-strand	544	1	5
α-helix	555-564	10
β-strand	570-571	2	5
α-helix	581-587	7
β-strand	596-599	4	5
α-helix	608-615	8
β-strand	621-624	4	5
α-helix	632-641	10
α-helix	660-667	8
α-helix	681-685	5

Chain C: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	18-28	11
β-strand	36-40	5	7
β-strand	43-47	5	7
α-helix	50-55	6
α-helix	57-63	7
β-strand	73-74	2	7
α-helix	81-93	13
β-strand	95-96	2	8
α-helix	104-106	3

Chain H: 12 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	364	1	9
α-helix	378-381	4
β-strand	390	1	9
β-strand	392	1	10
α-helix	401-408	8
β-strand	416	1	11
β-strand	418	1	10
β-strand	419	1	12
α-helix	428-435	8
β-strand	442	1	11
β-strand	443-444	2	13
β-strand	445	1	12
α-helix	453-462	10
β-strand	468	1	14
β-strand	469-470	2	13
α-helix	480-487	8
β-strand	494-496	3	14
α-helix	505-507	3
β-strand	520-522	3	14
β-strand	529	1	15
α-helix	530-535	6
β-strand	544-546	3	14
β-strand	548	1	16
β-strand	551	1	15
α-helix	555-564	10
β-strand	570-571	2	14
β-strand	574	1	16
α-helix	581-590	10
β-strand	596-599	4	14
β-strand	600	1	16
α-helix	608-615	8
β-strand	621-624	4	14
α-helix	632-641	10
α-helix	660-667	8

Chain I: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	17-28	12
β-strand	36-40	5	17
β-strand	43-47	5	17
α-helix	50-55	6
α-helix	57-64	8
β-strand	71-74	4	17
α-helix	81-93	13
β-strand	98-99	2	8
α-helix	104-106	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-box/LRR-repeat protein 17	B, H	protein	392	Homo sapiens	Q9UF56 (AlphaFold model)
Transcription regulator protein BACH1	C, I	protein	122	Homo sapiens	O14867 (AlphaFold model)

Sequence of entity 1 (B, H), FASTA

>8UBV_1 F-box/LRR-repeat protein 17 (chains B, H)
CHREPPPETPDINQLPPSILLKIFSNLSLDERCLSASLVCKYWRDLCLDFQFWKQLDLSS
RQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAYRCKQLSDTS
IIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIAKGC
LKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLDLRH
ITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSCKITDYAL
IAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLVQQYP
HITFSTVLQDCKRTLERAYQMGWTPNMSAASS

Sequence of entity 2 (C, I), FASTA

>8UBV_2 Transcription regulator protein BACH1 (chains C, I)
SVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQ
ADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFL
KF

Primary citation

Recognition of BACH1 quaternary structure degrons by two F-box proteins under oxidative stress. Cao, S., Garcia, S.F., Shi, H. et al. Cell (2024) 187:7568-7584.e22. DOI 10.1016/j.cell.2024.10.012 · PubMed

Other PDB entries of the same protein (UniProt Q9UF56 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UBT 3.1 Å, Structure of SCF-FBXL17-BACH1BTB E3 ligase complex
6W66 3.21 Å, The structure of the F64A, S172A mutant Keap1-BTB domain in complex with SKP1-FBXL17
8UAH 3.3 Å, Structure of BACH1 BTB domain-bound FBXL17 ubiquitin ligase
8UBU 4.6 Å, Cryo-EM structure of dimeric SCF-FBXL17-BACH1BTB E3 ligase complex close conformation
6WCQ 8.5 Å, Structure of a substrate-bound DQC ubiquitin ligase

Browse structure collections

About this viewer

MolViewer shows 8UBV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.