8UZ5: Actin, alpha cardiac muscle 1

The structure of the native cardiac thin filament troponin core in Ca2+-free rotated state from the lower strand. Determined by electron microscopy at 5.9 Å resolution. Released 6 Mar 2024.

Method: Electron microscopy
Resolution: 5.9 Å
Organism: Sus scrofa
Chains: 7
Atoms: 10,232
Mol. weight: 227.03 kDa
Ligands: ADP, MG
Released: 6 Mar 2024

Explore 8UZ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8UZ5 contains 62 α-helices and 42 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 22 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
β-strand	8	1	1
β-strand	11	1	2
β-strand	17-19	3	2
β-strand	21	1	1
β-strand	29-31	3	2
β-strand	35-38	4	3
β-strand	53-54	2	3
α-helix	55-59	5
α-helix	62-64	3
β-strand	65-68	4	3
β-strand	71	1	4
β-strand	76	1	4
α-helix	79-88	10
α-helix	89-94	6
α-helix	98-100	3
β-strand	103-107	5	1
α-helix	113-125	13
β-strand	131-136	6	1
α-helix	137-144	8
β-strand	150-155	6	5
β-strand	160-166	7	5
β-strand	169-170	2	5
α-helix	172-174	3
β-strand	176-178	3	5
α-helix	182-192	11
α-helix	193-195	3
α-helix	205-216	12
α-helix	223-230	8
β-strand	238-242	5	6
β-strand	245-250	6	6
α-helix	258-261	4
α-helix	274-283	10
α-helix	290-295	6
β-strand	297-300	4	5
α-helix	302-305	4
α-helix	309-320	12
β-strand	329-330	2	5
α-helix	338-347	10
α-helix	351-354	4
β-strand	357-358	2	1
α-helix	359-365	7
α-helix	367-369	3

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	4-10	7
α-helix	14-27	14
α-helix	38-47	10
α-helix	54-63	10
α-helix	74-84	11
α-helix	94-104	11
α-helix	114-124	11
α-helix	135-140	6
α-helix	150-156	7

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	46-80	35
α-helix	91-136	46
α-helix	152-154	3
α-helix	158-173	16

Chain E: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	199-206	8
α-helix	207-211	5
α-helix	223-268	46

Chains F and G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	135-214	80

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin, alpha cardiac muscle 1	A, B	protein	377	Sus scrofa	A0A8W4F696 (AlphaFold model)
Troponin C, slow skeletal and cardiac muscles	C	protein	161	Sus scrofa	P63317 (AlphaFold model)
Troponin I, cardiac muscle	D	protein	211	Sus scrofa	A0A4X1V520 (AlphaFold model)
Troponin T2, cardiac type	E	protein	285	Sus scrofa	A0A5G2Q8N0 (AlphaFold model)
Tropomyosin alpha-1 chain	F, G	protein	284	Sus scrofa	P42639

Sequence of entity 1 (A, B), FASTA

>8UZ5_1 Actin, alpha cardiac muscle 1 (chains A, B)
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF

Sequence of entity 2 (C), FASTA

>8UZ5_2 Troponin C, slow skeletal and cardiac muscles (chains C)
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Sequence of entity 3 (D), FASTA

>8UZ5_3 Troponin I, cardiac muscle (chains D)
MADRSGDAAGDSRPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQ
ELEREAEERRGEKGRALSTRCQPLELAGLSFAELQDLCRQLHARVDKVDEERYDVEAKVT
KNITEIADLNQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKETLDLRAHLKQVKKE
DTEKENREVGDWRKNIDALSGMEGRKKKFEG

Sequence of entity 4 (E), FASTA

>8UZ5_4 Troponin T2, cardiac type (chains E)
MSDVEETVDEYEEEQEEGAAEEQEEAVEEEAGGEAEAEEANAEEAGQEEDGREAEDGPME
ESKPKPRLFMPNLVPPKIPDGERVDFDDIHRKRMKDLNELQTLIEAHFENRKKEEELVSL
KDRIEKRRAERAEQQRIRTEREKERQTRLAEERARREEEENRRKAEDEARKKKALSNMMH
FGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNL
EAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK

Sequence of entity 5 (F, G), FASTA

>8UZ5_5 Tropomyosin alpha-1 chain (chains F, G)
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKRLEDELVSLQKKLKATEDELDKY
SEAPKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	2

Primary citation

Troponin Structural Dynamics in the Native Cardiac Thin Filament Revealed by Cryo Electron Microscopy. Risi, C.M., Belknap, B., Atherton, J. et al. J Mol Biol (2024) 436:168498-168498. DOI 10.1016/j.jmb.2024.168498 · PubMed

Other PDB entries of the same protein (UniProt A0A8W4F696 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9BPM 3.42 Å, cryo-EM structure of cardiac muscle alpha-actin A331P hcm mutant
8UWW 5.1 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free state from…
8V0K 5.2 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound partially…
8UYD 5.3 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free state from…
8UZY 5.3 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound partially…
8UZX 5.4 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound fully…
8UWY 5.5 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free rotated…
8V01 5.5 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound fully…
8V0I 5.8 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound fully…
8UWX 6.0 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free tilted…
8V0Y 7.0 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free state from…
8UZ6 7.1 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free tilted…

Browse structure collections

About this viewer

MolViewer shows 8UZ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.