8V2B: Oncostatin-M

Cryo-EM structure of mouse type II OSM receptor complex: model for full extracellular assembly. Determined by electron microscopy at 3.67 Å resolution. Released 20 Nov 2024.

Method: Electron microscopy
Resolution: 3.67 Å
Organism: Mus musculus
Chains: 3
Atoms: 12,049
Mol. weight: 179.25 kDa
Ligands: NAG
Released: 20 Nov 2024

Explore 8V2B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8V2B contains 36 α-helices and 115 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	33-46	14
α-helix	53-59	7
α-helix	65-73	9
α-helix	81-86	6
α-helix	89-114	26
α-helix	122-143	22
α-helix	147-149	3
α-helix	170-200	31

Chain B: 17 helices, 52 β-strands

Element	Residues	Length	Sheet
β-strand	31-32	2	1
β-strand	37-38	2	2
β-strand	43-48	6	1
α-helix	52-58	7
β-strand	65-69	5	3
β-strand	73	1	3
α-helix	74-75	2
β-strand	79-83	5	1
β-strand	86-92	7	1
β-strand	99-106	8	3
β-strand	112-120	9	3
β-strand	121-122	2	2
β-strand	130-137	8	4
β-strand	142-147	6	4
β-strand	157-163	7	5
β-strand	168	1	5
β-strand	172-173	2	5
β-strand	180-181	2	4
α-helix	185-186	2
β-strand	192-199	8	5
β-strand	204-206	3	5
β-strand	210-212	3	5
α-helix	214-217	4
β-strand	218-219	2	4
α-helix	220-223	4
β-strand	224-229	6	6
β-strand	238-243	6	6
α-helix	246-249	4
β-strand	253-260	8	7
β-strand	268-269	2	7
α-helix	270-271	2
α-helix	272-275	4
β-strand	281-284	4	6
β-strand	292-301	10	7
α-helix	308-311	4
β-strand	315-318	4	7
α-helix	319-321	3
α-helix	327-329	3
β-strand	330-334	5	8
β-strand	343-349	7	8
α-helix	351-353	3
β-strand	363-369	7	9
β-strand	376-380	5	9
β-strand	384-389	6	8
β-strand	394-401	8	9
β-strand	406	1	9
β-strand	410-414	5	9
β-strand	426-433	8	10
β-strand	436-442	7	10
β-strand	450-457	8	11
α-helix	463-466	4
β-strand	467-472	6	11
β-strand	477-479	3	10
β-strand	490-497	8	11
β-strand	502	1	11
β-strand	506-510	5	11
α-helix	520-522	3
β-strand	523-524	2	12
β-strand	528	1	13
β-strand	533-535	3	13
β-strand	536-537	2	12
α-helix	538-541	4
α-helix	542-545	4
β-strand	551-558	8	14
β-strand	564-569	6	14
β-strand	575-577	3	13
α-helix	580-581	2
β-strand	586-594	9	14
β-strand	597-606	10	14

Chain C: 11 helices, 63 β-strands

Element	Residues	Length	Sheet
β-strand	35-42	8	15
β-strand	47-53	7	15
β-strand	61-72	12	16
β-strand	78-89	12	16
α-helix	92-93	2
β-strand	94-99	6	15
β-strand	109-117	9	16
β-strand	135-137	3	16
β-strand	148-151	4	17
β-strand	155-158	4	18
β-strand	163-169	7	17
β-strand	174-178	5	18
β-strand	179	1	19
β-strand	184	1	19
β-strand	188	1	17
β-strand	194-199	6	17
β-strand	210-218	9	18
β-strand	223-231	9	18
α-helix	233-237	5
β-strand	241	1	20
β-strand	244	1	20
β-strand	249-253	5	20
β-strand	271-274	4	21
β-strand	284	1	21
β-strand	290-294	5	20
α-helix	295-296	2
β-strand	303-310	8	21
β-strand	315-322	8	21
β-strand	328	1	20
β-strand	334-340	7	22
β-strand	346-351	6	22
β-strand	361-369	9	23
β-strand	372-375	4	23
β-strand	378-380	3	23
β-strand	388	1	22
α-helix	391-392	2
β-strand	396-405	10	23
β-strand	416-421	6	23
α-helix	430-432	3
β-strand	433-440	8	24
β-strand	443-450	8	24
α-helix	451-453	3
α-helix	455-458	4
β-strand	464-471	8	25
β-strand	479-484	6	25
β-strand	489-494	6	24
β-strand	499-506	8	25
β-strand	511	1	25
α-helix	512-514	3
β-strand	515-518	4	25
β-strand	530-534	5	26
β-strand	536	1	27
β-strand	539	1	27
β-strand	542-543	2	28
β-strand	551-558	8	26
β-strand	560-561	2	26
β-strand	570-573	4	26
β-strand	580-581	2	28
β-strand	593-602	10	26
β-strand	606	1	25
β-strand	607-616	10	26
α-helix	625-628	4
β-strand	629	1	29
β-strand	633	1	29
β-strand	638-641	4	29
α-helix	643-645	3
β-strand	656-663	8	30
β-strand	673-677	5	30
β-strand	681-689	9	30
β-strand	695-698	4	29
β-strand	705-714	10	30
β-strand	719	1	30
α-helix	724-725	2
β-strand	726-730	5	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oncostatin-M	A	protein	183	Mus musculus	P53347 (AlphaFold model)
Interleukin-6 receptor subunit beta	B	protein	623	Mus musculus	Q00560 (AlphaFold model)
Oncostatin-M-specific receptor subunit beta	C	protein	715	Mus musculus	O70458 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8V2B_1 Oncostatin-M (chains A)
ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDT
LRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARL
LNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTR
SRR

Sequence of entity 2 (B), FASTA

>8V2B_2 Interleukin-6 receptor subunit beta (chains B)
QLLEPCGYIYPEFPVVQRGSNFTAICVLKEACLQHYYVNASYIVWKTNHAAVPREQVTVI
NRTTSSVTFTDVVLPSVQLTCNILSFGQIEQNVYGVTMLSGFPPDKPTNLTCIVNEGKNM
LCQWDPGRETYLETNYTLKSEWATEKFPDCQSKHGTSCMVSYMPTYYVNIEVWVEAENAL
GKVSSESINFDPVDKVKPTPPYNLSVTNSEELSSILKLSWVSSGLGGLLDLKSDIQYRTK
DASTWIQVPLEDTMSPRTSFTVQDLKPFTEYVFRIRSIKDSGKGYWSDWSEEASGTTYED
RPSRPPSFWYKTNPSHGQEYRSVRLIWKALPLSEANGKILDYEVILTQSKSVSQTYTVTG
TELTVNLTNDRYVASLAARNKVGKSAAAVLTIPSPHVTAAYSVVNLKAFPKDNLLWVEWT
PPPKPVSKYILEWCVLSENAPCVEDWQQEDATVNRTHLRGRLLESKCYQITVTPVFATGP
GGSESLKAYLKQAAPARGPTVRTKKVGKNEAVLAWDQIPVDDQNGFIRNYSISYRTSVGK
EMVVHVDSSHTEYTLSSLSSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEEQKLI
SEEDLGGEQKLISEEDLHHHHHH

Sequence of entity 3 (C), FASTA

>8V2B_3 Oncostatin-M-specific receptor subunit beta (chains C)
EVLEEPLPLTPEIHKVSFQLKLQEVNLEWTVPALTHEELNMIFQIEISRLNISNTIWVEN
YSTTVKREEAVRWNWTSDIPLECVKHFIRIRALVDDTKSLPQSSWGNWSSWKEVNAKVSV
EPDKSLIFPKDKVLEEGSNVTICLMYGQNVYNVSCKLQDEPIHGEQLDSHVSLLKLNNVV
FLSDTGTNINCQATKGPKRIFGTVLFVSKVLEEPKNVSCETRDFKTLDCSWEPGVDTTLT
WRKQRFQNYTLCESFSKRCEVSNYRNSYTWQITEGSQEMYNFTLTAENQLRKRSVNINFN
LTHRVHPKAPQDVTLKIIGATKANMTWKVHSHGNNYTLLCQVKLQYGEVIHEHNVSVHMS
ANYLFSDLDPDTKYKAFVRCASANHFWKWSDWTQKEFSTPETAPSQALDVWRQVWSENGR
RIVTLFWKPLLKSQANGKIISYNIVVENEAKPTESEHYCVWAPALSTNLSLDLQPYKIRI
TTNNSMGASPESLMVLSNDSGHEEVKEKTIKGIKDAFNISWEPVSGDTMGYVVDWCAHSQ
DQRCDLQWKNLGPNTTSTTITSDDFKPGVRYNFRIFERSVEHKARLVEKQRGYTQELAPL
VNPKVEIPYSTPNSFVLRWPDYDSDFQAGFIKGYLVYVKSKEMQCNQPWERTLLPDNSVL
CKYDINGSETKTLTVENLQPESLYEFFVTPYTSAGPGPNETFTKVTTPDARSHML

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	7

Primary citation

Structures of complete extracellular assemblies of type I and type II Oncostatin M receptor complexes. Zhou, Y., Stevis, P.E., Cao, J. et al. Nat Commun (2024) 15:9776-9776. DOI 10.1038/s41467-024-54124-1 · PubMed

Other PDB entries of the same protein (UniProt P53347 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8V2C 3.46 Å, Cryo-EM structure of mouse type II OSM receptor complex: model for assembly core region

Browse structure collections

About this viewer

MolViewer shows 8V2B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.