8VCH: PDB entry 8VCH

Voltage gated potassium ion channel Kv1.2 W366F, C-type inactivated. Determined by electron microscopy at 2.55 Å resolution. Released 10 Jul 2024.

Method: Electron microscopy
Resolution: 2.55 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 7,614
Mol. weight: 242.29 kDa
Released: 10 Jul 2024

Explore 8VCH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VCH contains 58 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	146-154	9
α-helix	156-158	3
α-helix	160-183	24
α-helix	221-243	23
α-helix	250-252	3
α-helix	254-261	8
α-helix	264-274	11
α-helix	291-299	9
α-helix	300-309	10
α-helix	312-323	12
α-helix	325-349	25
α-helix	362-364	3
α-helix	365-372	8
α-helix	385-402	18
α-helix	406-418	13

Chains B and D: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	146-154	9
α-helix	156-158	3
α-helix	160-183	24
α-helix	221-243	23
α-helix	254-261	8
α-helix	264-274	11
α-helix	291-299	9
α-helix	300-309	10
α-helix	312-323	12
α-helix	325-349	25
α-helix	362-364	3
α-helix	365-372	8
α-helix	385-402	18
α-helix	406-418	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Potassium voltage-gated channel subfamily A member 2	A, B, C, D	protein	536	Rattus norvegicus	P63142 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8VCH_1 Potassium voltage-gated channel subfamily A member 2 (chains A, B, C, D)
MSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKLVPRGSMTVATGDPVDEAAAHPGHPQDTY
DPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRP
SFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPEN
EFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFH
TYSQSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAI
IPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKA
SMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFFWAVVSMTTVGYGDMVPT
TIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPD
LKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV

Primary citation

Cryo-EM structures of Kv1.2 potassium channels, conducting and non-conducting. Wu, Y., Yan, Y., Yang, Y. et al. bioRxiv (2024). DOI 10.1101/2023.06.02.543446 · PubMed

Other PDB entries of the same protein (UniProt P63142 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DSX 1.6 Å, KV1.2 T1 domain, residues 33-119, T46V mutant
1QDV 1.6 Å, N-terminal domain, voltage-gated potassium channel KV1.2 residues 33-131
1QDW 2.1 Å, N-terminal domain, voltage-gated potassium channel KV1.2 residues 33-119
4JTA 2.5 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin
4JTD 2.54 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of…
4JTC 2.56 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+
2A79 2.9 Å, Mammalian Shaker Kv1.2 potassium channel- beta subunit complex
3LNM 2.9 Å, F233W mutant of the Kv2.1 paddle-Kv1.2 chimera channel
3LUT 2.9 Å, A Structural Model for the Full-length Shaker Potassium Channel Kv1.2
6EBL 3.0 Å, The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic…
7SIZ 3.1 Å, C-type inactivation in a voltage gated K+ channel
8VC4 3.17 Å, Voltage gated potassium ion channel Kv1.2 in Sodium

Browse structure collections

About this viewer

MolViewer shows 8VCH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.