AP-6 bound human TMEM175. Determined by electron microscopy at 3.48 Å resolution. Released 14 Aug 2024.
Explore 8VIC in 3D Show helices and sheets RCSB PDB PDBe
8VIC contains 45 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 31 | 1 | 1 |
| α-helix | 34-48 | 15 | |
| α-helix | 49-51 | 3 | |
| α-helix | 52-57 | 6 | |
| α-helix | 68-101 | 34 | |
| β-strand | 105 | 1 | 1 |
| α-helix | 107-120 | 14 | |
| α-helix | 123-132 | 10 | |
| α-helix | 137-163 | 27 | |
| α-helix | 165-167 | 3 | |
| α-helix | 255-257 | 3 | |
| α-helix | 258-273 | 16 | |
| α-helix | 275-283 | 9 | |
| α-helix | 286-287 | 2 | |
| α-helix | 288-294 | 7 | |
| α-helix | 299-305 | 7 | |
| α-helix | 307-332 | 26 | |
| β-strand | 334 | 1 | 2 |
| α-helix | 339-352 | 14 | |
| α-helix | 355-363 | 9 | |
| α-helix | 369-399 | 31 | |
| α-helix | 401-403 | 3 | |
| β-strand | 405 | 1 | 2 |
| α-helix | 407-409 | 3 | |
| α-helix | 416-439 | 24 | |
| α-helix | 444-460 | 17 | |
| α-helix | 462-472 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 31 | 1 | 3 |
| α-helix | 34-48 | 15 | |
| α-helix | 52-56 | 5 | |
| α-helix | 68-101 | 34 | |
| β-strand | 105 | 1 | 3 |
| α-helix | 107-120 | 14 | |
| α-helix | 123-132 | 10 | |
| α-helix | 137-163 | 27 | |
| α-helix | 165-167 | 3 | |
| α-helix | 255-257 | 3 | |
| α-helix | 258-273 | 16 | |
| α-helix | 275-283 | 9 | |
| α-helix | 286-287 | 2 | |
| α-helix | 288-294 | 7 | |
| α-helix | 299-305 | 7 | |
| α-helix | 307-330 | 24 | |
| β-strand | 334 | 1 | 4 |
| α-helix | 339-352 | 14 | |
| α-helix | 355-363 | 9 | |
| α-helix | 369-399 | 31 | |
| α-helix | 401-403 | 3 | |
| β-strand | 405 | 1 | 4 |
| α-helix | 407-409 | 3 | |
| α-helix | 416-439 | 24 | |
| α-helix | 444-460 | 17 | |
| α-helix | 462-472 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endosomal/lysosomal potassium channel TMEM175 | A, B | protein | 504 | Homo sapiens | Q9BSA9 (AlphaFold model) |
>8VIC_1 Endosomal/lysosomal potassium channel TMEM175 (chains A, B) MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEI SPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTI TFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRAL YRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREP SAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLV AALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQ QTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMF AKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLA RPEHPPPAPTGQDDPQSQLLPAPC
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1AA3 | (2P,2'P)-2,2'-(1,3-phenylene)di(pyridin-4-amine) | C16 H14 N4 | 1 |
Discovery of Selective Inhibitors for the Lysosomal Parkinson's Disease Channel TMEM175. Oh, S., Lee, J., Choi, H.J. et al. J Am Chem Soc (2024) 146:23230-23239. DOI 10.1021/jacs.4c05623 · PubMed
Other PDB entries of the same protein (UniProt Q9BSA9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8VIC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.