8VIE: 2-PPA bound human TMEM175

2-PPA bound human TMEM175. Determined by electron microscopy at 3.52 Å resolution. Released 14 Aug 2024.

Method: Electron microscopy
Resolution: 3.52 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,709
Mol. weight: 111.5 kDa
Ligands: A1AB0
Released: 14 Aug 2024

Explore 8VIE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VIE contains 42 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 21 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	31	1	1
α-helix	34-48	15
α-helix	52-57	6
α-helix	67-100	34
β-strand	105	1	1
α-helix	107-121	15
α-helix	123-132	10
α-helix	138-163	26
α-helix	165-167	3
α-helix	258-273	16
α-helix	275-283	9
α-helix	285-287	3
α-helix	288-293	6
α-helix	299-332	34
β-strand	334	1	2
α-helix	339-352	14
α-helix	355-363	9
α-helix	365-366	2
α-helix	369-399	31
α-helix	401-404	4
β-strand	405	1	2
α-helix	407-409	3
α-helix	416-439	24
α-helix	444-460	17
α-helix	462-474	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endosomal/lysosomal potassium channel TMEM175	A, B	protein	504	Homo sapiens	Q9BSA9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8VIE_1 Endosomal/lysosomal potassium channel TMEM175 (chains A, B)
MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEI
SPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTI
TFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRAL
YRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREP
SAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLV
AALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQ
QTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMF
AKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLA
RPEHPPPAPTGQDDPQSQLLPAPC

Ligands and cofactors

ID	Name	Formula	Copies
A1AB0	2-phenylpyridin-4-amine	C11 H10 N2	1

Primary citation

Discovery of Selective Inhibitors for the Lysosomal Parkinson's Disease Channel TMEM175. Oh, S., Lee, J., Choi, H.J. et al. J Am Chem Soc (2024) 146:23230-23239. DOI 10.1021/jacs.4c05623 · PubMed

Other PDB entries of the same protein (UniProt Q9BSA9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UNL 2.45 Å, Human TMEM175 in an open state
7UNM 2.61 Å, Human TMEM175 in an closed state
6WC9 2.64 Å, Human open state TMEM175 in KCl
8DHM 2.73 Å, Human TMEM175 in complex with 4-aminopyridine
9VSQ 2.74 Å, The TUG-891-bound structure of TMEM175
9VSR 2.92 Å, The DCY1040 and TUG-891-bound structure of TMEM175
6WCA 3.03 Å, Human closed state TMEM175 in KCl
6WCB 3.17 Å, Human open state TMEM175 in CsCl
6W8N 3.2 Å, Structure of a trans-membrane protein
6WCC 3.24 Å, Human closed state TMEM175 in CsCl
6W8O 3.4 Å, Structure of an Apo membrane protein
8FYF 3.4 Å, Human TMEM175-LAMP1 transmembrane domain only complex

Browse structure collections

About this viewer

MolViewer shows 8VIE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.