Structure of Human Neurolysin in complex with dynorphin A8(1-8) peptide. Determined by X-ray diffraction at 2.12 Å resolution. Released 21 Aug 2024.
Explore 8VJV in 3D Show helices and sheets RCSB PDB PDBe
8VJV contains 46 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-54 | 24 | |
| α-helix | 57-59 | 3 | |
| α-helix | 62-66 | 5 | |
| α-helix | 67-84 | 18 | |
| α-helix | 86-89 | 4 | |
| α-helix | 93-114 | 22 | |
| α-helix | 117-129 | 13 | |
| α-helix | 132-134 | 3 | |
| α-helix | 137-151 | 15 | |
| α-helix | 159-184 | 26 | |
| β-strand | 189-192 | 4 | 1 |
| α-helix | 195-197 | 3 | |
| α-helix | 202-205 | 4 | |
| β-strand | 209-210 | 2 | 1 |
| β-strand | 216-219 | 4 | 1 |
| α-helix | 222-231 | 10 | |
| α-helix | 235-245 | 11 | |
| α-helix | 250-270 | 21 | |
| α-helix | 276-281 | 6 | |
| α-helix | 289-325 | 37 | |
| α-helix | 335-337 | 3 | |
| α-helix | 338-350 | 13 | |
| α-helix | 354-357 | 4 | |
| α-helix | 358-360 | 3 | |
| β-strand | 362 | 1 | 2 |
| α-helix | 363-377 | 15 | |
| β-strand | 380-384 | 5 | 3 |
| α-helix | 385 | 1 | |
| β-strand | 396-402 | 7 | 3 |
| β-strand | 408-415 | 8 | 3 |
| β-strand | 427-432 | 6 | 3 |
| β-strand | 436 | 1 | 4 |
| α-helix | 441 | 1 | |
| β-strand | 442 | 1 | 4 |
| α-helix | 443-444 | 2 | |
| β-strand | 445-450 | 6 | 3 |
| α-helix | 453-455 | 3 | |
| β-strand | 463 | 1 | 2 |
| α-helix | 466-484 | 19 | |
| α-helix | 490-492 | 3 | |
| α-helix | 504-509 | 6 | |
| α-helix | 510-514 | 5 | |
| α-helix | 516-522 | 7 | |
| α-helix | 530-533 | 4 | |
| α-helix | 534-542 | 9 | |
| α-helix | 543-545 | 3 | |
| α-helix | 548-565 | 18 | |
| α-helix | 573-580 | 8 | |
| α-helix | 581-585 | 5 | |
| α-helix | 588-590 | 3 | |
| α-helix | 595-598 | 4 | |
| α-helix | 600-602 | 3 | |
| α-helix | 612-623 | 12 | |
| α-helix | 624-628 | 5 | |
| α-helix | 636-642 | 7 | |
| α-helix | 643-647 | 5 | |
| α-helix | 655-663 | 9 | |
| α-helix | 670-675 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neurolysin, mitochondrial | A | protein | 667 | Homo sapiens | Q9BYT8 (AlphaFold model) |
| Dynorphin A(1-8) | D | protein | 8 | Homo sapiens | P01213 (AlphaFold model) |
>8VJV_1 Neurolysin, mitochondrial (chains A) SSYTVAGRNVLRWDLSPEQIKTRTEELIVQTKQVYDAVGMLGIEEVTYENCLQALADVEV KYIVERTMLDFPQHVSSDKEVRAASTEADKRLSRFDIEMSMRGDIFERIVHLQETCDLGK IKPEARRYLEKSIKMGKRNGLHLPEQVQNEIKSMKKRMSELCIDFNKNLNEDDTFLVFSK AELGALPDDFIDSLEKTDDDKYKITLKYPHYFPVMKKCCIPETRRRMEMAFNTRCKEENT IILQQLLPLRTKVAKLLGYSTHADFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFI LNLKKKECKDRGFEYDGKINAWDLYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNTY QELLGLSFEQMTDAHVWNKSVTLYTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPG CLLPDGSRMMAVAALVVNFSQPVAGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSG TNVETDFVEVPSQMLENWVWDVDSLRRLSKHYKDGSPIADDLLEKLVASRLVNTGLLTLR QIVLSKVDQSLHTNTSLDAASEYAKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGYL WSEVFSMDMFYSCFKKEGIMNPEVGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLM SRGLHAP
>8VJV_2 Dynorphin A(1-8) (chains D) YGGFLRRI
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (EDO, CL) are not listed.
Structural basis of divergent substrate recognition and inhibition of human neurolysin. Shi, K., Bagchi, S., Bickel, J. et al. Sci Rep (2024) 14:18420-18420. DOI 10.1038/s41598-024-67639-w · PubMed
Other PDB entries of the same protein (UniProt Q9BYT8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8VJV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.