8VWO: HRpn13 Pru

Crystal structure of hRpn13 Pru bound with U-shaped peptide. Determined by X-ray diffraction at 1.85 Å resolution. Released 9 Jul 2025.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,037
Mol. weight: 17.51 kDa
Released: 9 Jul 2025

Explore 8VWO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VWO contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	1
β-strand	28-30	3	2
β-strand	31-34	4	3
β-strand	37-40	4	3
β-strand	45-51	7	1
β-strand	57-63	7	1
β-strand	69-74	6	1
β-strand	80-84	5	2
β-strand	93-98	6	2
α-helix	100-102	3
β-strand	104-109	6	2
α-helix	117-129	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proteasomal ubiquitin receptor ADRM1	A	protein	150	Homo sapiens	Q16186 (AlphaFold model)
Gly-pro-gly-ser-met-thr-thr	B	protein	7	Homo sapiens

Sequence of entity 1 (A), FASTA

>8VWO_1 Proteasomal ubiquitin receptor ADRM1 (chains A)
MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
WKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNEYLNNPPMPGALGASGSSGHELSAL

Sequence of entity 2 (B), FASTA

>8VWO_2 GLY-PRO-GLY-SER-MET-THR-THR (chains B)
GPGSMTT

Primary citation

An adaptive peptide-binding site in ubiquitin receptor hRpn13 revealed by structural studies. Hassan, B., Chandravanshi, M., Ng, M.Y. et al. Nat Commun (2025) 16:5669-5669. DOI 10.1038/s41467-025-60843-w · PubMed

Other PDB entries of the same protein (UniProt Q16186 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V1Y 1.42 Å, Crystal structure of the ternary RPN13 PRU-RPN2 (940-953)-ubiquitin complex
6OI4 1.76 Å, RPN13 (19-132)-RPN2 (940-952) pY950-Ub complex
5IRS 1.8 Å, crystal structure of the proteasomal Rpn13 PRU-domain
4WLR 2.0 Å, Crystal Structure of mUCH37-hRPN13 CTD-hUb complex
5V1Z 2.0 Å, Crystal structure of the RPN13 PRU-RPN2 (932-953)-ubiquitin complex
8FTQ 2.1 Å, Crystal structure of hRpn13 Pru domain in complex with Ubiquitin and XL44
4UEL 2.3 Å, UCH-L5 in complex with ubiquitin-propargyl bound to the RPN13 DEUBAD domain
9E7K 2.41 Å, Crystal structure of the UCH37 RPN13 DEUBAD complex bound to an inhibitory nanobody in…
4UEM 2.82 Å, UCH-L5 in complex with the RPN13 DEUBAD domain
4WLQ 2.85 Å, Crystal structure of mUCH37-hRPN13 CTD complex
2KQZ Solution structure of the Rpn13 DEUBAD domain
2KR0 Solution structure of the proteasome ubiquitin receptor Rpn13

Browse structure collections

About this viewer

MolViewer shows 8VWO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.