8W3V: Human WDR41

Crystal structure of human WDR41. Determined by X-ray diffraction at 2.2 Å resolution. Released 27 Mar 2024.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,960
Mol. weight: 84.16 kDa
Released: 27 Mar 2024

Explore 8W3V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8W3V contains 2 α-helices and 66 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 32 β-strands

Element	Residues	Length	Sheet
β-strand	36-39	4	1
β-strand	46-51	6	2
β-strand	56-61	6	2
β-strand	66-70	5	2
β-strand	76-80	5	2
β-strand	87-93	7	3
β-strand	105-110	6	3
β-strand	115-119	5	3
β-strand	125-129	5	3
β-strand	138-142	5	4
β-strand	147-151	5	4
β-strand	155-158	4	4
β-strand	164-167	4	4
β-strand	176-182	7	5
β-strand	186-191	6	5
β-strand	194-201	8	5
α-helix	202-204	3
β-strand	211-218	8	5
β-strand	225-231	7	6
β-strand	235-240	6	6
β-strand	245-249	5	6
β-strand	255-259	5	6
β-strand	286-291	6	7
β-strand	295-300	6	7
β-strand	303-308	6	7
β-strand	313-318	6	7
β-strand	326-331	6	8
β-strand	337-341	5	8
β-strand	346-350	5	8
β-strand	396-401	6	8
β-strand	408-414	7	1
β-strand	418-423	6	1
β-strand	428-431	4	1

Chain B: 1 helix, 34 β-strands

Element	Residues	Length	Sheet
β-strand	35-40	6	9
β-strand	46-51	6	10
β-strand	56-61	6	10
β-strand	65-70	6	10
β-strand	76-81	6	10
β-strand	87-93	7	11
β-strand	105-110	6	11
β-strand	114-118	5	11
α-helix	120-122	3
β-strand	125-129	5	11
β-strand	138-142	5	12
β-strand	147-151	5	12
β-strand	155-158	4	12
β-strand	164-167	4	12
β-strand	178-182	5	13
β-strand	186-191	6	13
β-strand	194-201	8	13
β-strand	205	1	14
β-strand	207	1	14
β-strand	211-218	8	13
β-strand	225-231	7	15
β-strand	235-240	6	15
β-strand	245-249	5	15
β-strand	255-259	5	15
β-strand	286-291	6	16
β-strand	295-300	6	16
β-strand	304-308	5	16
β-strand	314-318	5	16
β-strand	326-330	5	17
β-strand	337-341	5	17
β-strand	346-350	5	17
β-strand	396-401	6	17
β-strand	408-414	7	9
β-strand	418-423	6	9
β-strand	427-432	6	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
WD repeat-containing protein 41	A, B	protein	373	Homo sapiens	Q9HAD4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8W3V_1 WD repeat-containing protein 41 (chains A, B)
QNPYTELLVLKAHHDIVRFLVQLDDYRFASAGDDGIVVVWNAQTGEKLLELNGHTQKITA
IITFPSLESCEEKNQLILTASADRTVIVWDGDTTRQVQRISCFQSTVKCLTVLQRLDVWL
SGGNDLCVWNRKLDLLCKTSHLSDTGISALVEIPANCVVAAVGKELIIFRLVAPTEGSLA
WAILEVKRLLDHQDNILSLINVNDLSFVTGSHVGELIIWDALDWTMQAYERNFWDPSPQL
DTQQEIKLCQKSNDISIHHFTCDEENVFAAVGRGLYVYSLQMKRVIACQKTAHDSNVLHV
ARLPNRQLISCSEDGSVRIWELREKQQLELIGDLIGHSSSVEMFLYFEDHGLVTCSADHL
IILWKNGERESGL

Primary citation

Crystal structure of human WDR41. Hutchinson, A., Dong, A., Li, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q9HAD4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6LT0 3.2 Å, cryo-EM structure of C9ORF72-SMCR8-WDR41
6V4U 3.8 Å, Cryo-EM structure of SMCR8-C9orf72-WDR41 complex
7MGE 3.94 Å, Structure of C9orf72:SMCR8:WDR41 in complex with ARF1

Browse structure collections

About this viewer

MolViewer shows 8W3V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.