8W59: E3 ubiquitin-protein ligase XIAP

Crystal structure of the RING domain of human XIAP treated with arsenic trioxide. Determined by X-ray diffraction at 1.34 Å resolution. Released 27 Sept 2023.

Method: X-ray diffraction
Resolution: 1.34 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,041
Mol. weight: 14.98 kDa
Ligands: ZN, CA
Released: 27 Sept 2023

Explore 8W59 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8W59 contains 10 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	437-447	11
β-strand	449	1	1
β-strand	457	1	1
α-helix	458	1
β-strand	460-463	4	2
β-strand	468	1	2
α-helix	472-475	4
β-strand	480	1	3
α-helix	486	1
β-strand	487	1	3
α-helix	488	1
β-strand	490-493	4	2
α-helix	494	1

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	437-446	10
β-strand	449	1	4
β-strand	457	1	4
β-strand	460-463	4	5
β-strand	468-470	3	5
α-helix	472-475	4
β-strand	480	1	6
α-helix	486	1
β-strand	487	1	6
α-helix	488	1
β-strand	490-493	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase XIAP	A, B	protein	63	Homo sapiens	P98170 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8W59_1 E3 ubiquitin-protein ligase XIAP (chains A, B)
EISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQK
IFM

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4
CA	Calcium ion	Ca	1

Primary citation

Crystal structure of the RING domain of human XIAP. Zhang, Q., Sun, H. To be published.

Other PDB entries of the same protein (UniProt P98170 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4J44 1.3 Å, Crystal structure of XIAP-BIR2 domain with AIAV bound
4J47 1.35 Å, Crystal structure of XIAP-BIR2 domain with SVPI bound
4J46 1.42 Å, Crystal structure of XIAP-BIR2 domain with AVPI bound
4J3Y 1.45 Å, Crystal structure of XIAP-BIR2 domain
4J45 1.48 Å, Crystal structure of XIAP-BIR2 domain with ATAA bound
5O6T 1.57 Å, BIRC4 RING in complex with dimeric ubiquitin variant
4KJU 1.6 Å, Crystal structure of XIAP-Bir2 with a bound benzodiazepinone inhibitor.
8W5A 1.65 Å, Crystal structure of the RING domain of human XIAP
4KJV 1.7 Å, Crystal structure of XIAP-Bir2 with a bound spirocyclic benzoxazepinone inhibitor.
3UW5 1.71 Å, Crystal structure of the BIR domain of MLIAP bound to GDC0152
8GH7 1.75 Å, 142D6 bound to BIR3-XIAP
4IC3 1.78 Å, Crystal structure of the F495L mutant XIAP RING domain

Browse structure collections

About this viewer

MolViewer shows 8W59 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.