Crystal structure of the Melanocortin-4 Receptor (MC4R) in complex with S31. Determined by X-ray diffraction at 3.3 Å resolution. Released 7 Aug 2024.
Explore 8WKZ in 3D Show helices and sheets RCSB PDB PDBe
8WKZ contains 23 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 48-71 | 24 | |
| α-helix | 73-75 | 3 | |
| α-helix | 78-110 | 33 | |
| α-helix | 118-152 | 35 | |
| α-helix | 154-160 | 7 | |
| α-helix | 163-186 | 24 | |
| α-helix | 191-212 | 22 | |
| α-helix | 213-217 | 5 | |
| α-helix | 219-222 | 4 | |
| α-helix | 1009-1011 | 3 | |
| α-helix | 1016-1026 | 11 | |
| β-strand | 1033-1038 | 6 | 1 |
| α-helix | 1048-1059 | 12 | |
| α-helix | 1063-1066 | 4 | |
| β-strand | 1067-1072 | 6 | 1 |
| α-helix | 1077-1088 | 12 | |
| β-strand | 1093-1096 | 4 | 1 |
| α-helix | 1102-1109 | 8 | |
| β-strand | 1114-1117 | 4 | 1 |
| α-helix | 1126-1133 | 8 | |
| β-strand | 1137-1141 | 5 | 1 |
| α-helix | 1145-1149 | 5 | |
| β-strand | 1156-1158 | 3 | 1 |
| α-helix | 1163-1176 | 14 | |
| α-helix | 1182-1193 | 12 | |
| α-helix | 239-270 | 32 | |
| α-helix | 275-281 | 7 | |
| α-helix | 284-304 | 21 | |
| α-helix | 307-319 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Melanocortin receptor 4 | A | protein | 535 | Homo sapiens | P32245 (AlphaFold model), Q9V2J8 (AlphaFold model) |
| [N-(3-{bis[2-(pyridin-2-yl-kappaN)ethyl]amino-kappaN}propyl)-5-(2-oxohexahydro-1H-thieno[3,4-d]imid… | B | protein | 10 | synthetic construct |
>8WKZ_1 Melanocortin receptor 4 (chains A) MKTIIALSYIFCLVFADYKDDDDAGRAWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSP VVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSLGFETIVITLLN STDTDAQSFTVNIDNVIDSVICASLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGI IISCIWAACTVSGILFIIYSDSSAVIICLITMFFTMLALMASLYVHMFLMARLHGIDCSF WNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQE MRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGL VALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRE NCKKRAMSFSRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFN LYLILIMCNSIINPLIYALRSQELRKTFKEIICCYEFLEVLFQGPHHHHHHHHHH
>8WKZ_2 [N-(3-{bis[2-(pyridin-2-yl-kappaN)ethyl]amino-kappaN}propyl)-5-(2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl)pentanamide](azido)(hydroxy)copper (chains B)
XLDPXRWRKXNovel Cocrystal Structures of Peptide Antagonists Bound to the Human Melanocortin Receptor 4 Unveil Unexplored Grounds for Structure-Based Drug Design. Gimenez, L.E., Martin, C., Yu, J. et al. J Med Chem (2024) 67:2690-2711. DOI 10.1021/acs.jmedchem.3c01822 · PubMed
Other PDB entries of the same protein (UniProt P32245 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8WKZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.