8WLG: Polyhedrin,Myc proto-oncogene protein

Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment. Determined by X-ray diffraction at 2.55 Å resolution. Released 5 Jun 2024.

Method: X-ray diffraction
Resolution: 2.55 Å
Organisms: Bombyx mori cytoplasmic polyhedrosis virus, Homo sapiens
Chains: 1
Atoms: 1,330
Mol. weight: 28.36 kDa
Released: 5 Jun 2024

Explore 8WLG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WLG contains 9 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	15-18	4
α-helix	25-28	4
β-strand	34-43	10	1
β-strand	48-56	9	1
β-strand	58-65	8	2
β-strand	106-113	8	1
β-strand	117-126	10	2
α-helix	137-139	3
β-strand	144	1	2
α-helix	147-149	3
α-helix	150	1
β-strand	151-155	5	1
β-strand	158-167	10	1
β-strand	175-183	9	2
α-helix	197-206	10
β-strand	208-214	7	1
α-helix	217-219	3
α-helix	220-225	6
α-helix	226-228	3
β-strand	232-233	2	3
β-strand	239-240	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polyhedrin,Myc proto-oncogene protein	A	protein	248	Bombyx mori cytoplasmic polyhedrosis virus, Homo sapiens	P01106 (AlphaFold model), P11041

Sequence of entity 1 (A), FASTA

>8WLG_1 Polyhedrin,Myc proto-oncogene protein (chains A)
MADVAGTSNRDFRGYILSVQAEEQYNYNNSLNGEVSVWVYAYYSDGSVLVINKNSQYKVG
ISETFKALKEYREGQHNDSYDEYEVNQSIYYPNGGDARKFHSNAKPRAIQIIFSPSVNVR
TIKMAKGNAVSVPDEYLQRSHPWEATGIKYRKIKRDGEIVGYSHYFELPHEYNSISLAVS
GVHKNPSSYNVGSAHNVMDVFQSCDLALRFCNRYWAELELVNHYISPNAYPYLDINNHSY
GVALSNRQ

Primary citation

High-throughput structure determination of an intrinsically disordered protein using cell-free protein crystallization. Kojima, M., Abe, S., Furuta, T. et al. Proc Natl Acad Sci U S A (2024) 121:e2322452121-e2322452121. DOI 10.1073/pnas.2322452121 · PubMed

Other PDB entries of the same protein (UniProt P01106 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QNH 1.3 Å, Myc pS294 phosphopeptide binding to 14-3-3sigma
6G6K 1.35 Å, The crystal structures of Human MYC:MAX bHLHZip complex
1NKP 1.8 Å, Crystal structure of Myc-Max recognizing DNA
8Q1N 1.84 Å, Cyclic peptide binder of the WBM-site of WDR5
4Y7R 1.9 Å, Crystal structure of WDR5 in complex with MYC MbIIIb peptide
8J2Q 1.92 Å, Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment
5I4Z 1.95 Å, Structure of apo OmoMYC
8X8V 2.0 Å, Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment
8X8S 2.04 Å, Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment
1EE4 2.1 Å, Crystal structure of yeast karyopherin (importin) alpha in a complex with a C-myc nls…
6G6L 2.2 Å, The crystal structures of Human MYC:MAX bHLHZip complex
6G6J 2.25 Å, The crystal structures of Human MYC:MAX bHLHZip complex

Browse structure collections

About this viewer

MolViewer shows 8WLG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.