8WQA: CUL2-RBX1-ELOB-ELOC-FEM1B
Cryo-EM structure of CUL2-RBX1-ELOB-ELOC-FEM1B bound with the C-degron of CCDC89 (conformation 1). Determined by electron microscopy at 3.39 Å resolution. Released 3 Apr 2024.
- Method
- Electron microscopy
- Resolution
- 3.39 Å
- Organism
- Homo sapiens
- Chains
- 12
- Atoms
- 26,479
- Mol. weight
- 392.16 kDa
- Ligands
- ZN
- Released
- 3 Apr 2024
Explore 8WQA in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8WQA contains 179 α-helices and 81 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 39 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-25 | 16 | |
| α-helix | 32-46 | 15 | |
| α-helix | 54-78 | 25 | |
| α-helix | 83-104 | 22 | |
| α-helix | 106-108 | 3 | |
| α-helix | 109-113 | 5 | |
| α-helix | 136-138 | 3 | |
| α-helix | 139-147 | 9 | |
| α-helix | 148-152 | 5 | |
| α-helix | 156-171 | 16 | |
| α-helix | 178-190 | 13 | |
| α-helix | 191-194 | 4 | |
| α-helix | 201-203 | 3 | |
| α-helix | 204-208 | 5 | |
| α-helix | 209-227 | 19 | |
| α-helix | 232-251 | 20 | |
| α-helix | 256-258 | 3 | |
| α-helix | 259-267 | 9 | |
| α-helix | 268-272 | 5 | |
| α-helix | 275-287 | 13 | |
| α-helix | 291-301 | 11 | |
| α-helix | 308-327 | 20 | |
| α-helix | 335-356 | 22 | |
| α-helix | 362-376 | 15 | |
| α-helix | 387-399 | 13 | |
| β-strand | 400 | 1 | 26 |
| α-helix | 408-422 | 15 | |
| α-helix | 428-444 | 17 | |
| β-strand | 448 | 1 | 26 |
| α-helix | 451-469 | 19 | |
| α-helix | 472-493 | 22 | |
| β-strand | 506-507 | 2 | 20 |
| β-strand | 510-513 | 4 | 21 |
| α-helix | 531-546 | 16 | |
| β-strand | 551-555 | 5 | 21 |
| β-strand | 561-565 | 5 | 20 |
| α-helix | 567-569 | 3 | |
| β-strand | 574-576 | 3 | 27 |
| β-strand | 577-578 | 2 | 20 |
| α-helix | 579-581 | 3 | |
| α-helix | 582-590 | 9 | |
| β-strand | 593-594 | 2 | 28 |
| α-helix | 596-603 | 8 | |
| α-helix | 607-618 | 12 | |
| β-strand | 623-625 | 3 | 28 |
| β-strand | 638-640 | 3 | 28 |
| β-strand | 650-652 | 3 | 27 |
| α-helix | 656-658 | 3 | |
| α-helix | 662-691 | 30 | |
| β-strand | 694-695 | 2 | 29 |
| α-helix | 696-707 | 12 | |
| α-helix | 715-727 | 13 | |
| β-strand | 731-733 | 3 | 29 |
| β-strand | 740-743 | 4 | 29 |
Chain B: 39 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-14 | 12 | |
| α-helix | 17-24 | 8 | |
| α-helix | 29-35 | 7 | |
| β-strand | 40-42 | 3 | 30 |
| β-strand | 45-47 | 3 | 30 |
| α-helix | 49-55 | 7 | |
| α-helix | 59-67 | 9 | |
| α-helix | 91-97 | 7 | |
| α-helix | 101-110 | 10 | |
| α-helix | 124-131 | 8 | |
| α-helix | 134-141 | 8 | |
| α-helix | 157-163 | 7 | |
| α-helix | 167-175 | 9 | |
| α-helix | 190-196 | 7 | |
| α-helix | 200-208 | 9 | |
| α-helix | 222-228 | 7 | |
| α-helix | 232-235 | 4 | |
| α-helix | 238-241 | 4 | |
| α-helix | 247-261 | 15 | |
| α-helix | 270-283 | 14 | |
| α-helix | 295-297 | 3 | |
| α-helix | 300-302 | 3 | |
| α-helix | 311-316 | 6 | |
| α-helix | 321-336 | 16 | |
| α-helix | 341-343 | 3 | |
| α-helix | 344-356 | 13 | |
| α-helix | 360-376 | 17 | |
| α-helix | 382-397 | 16 | |
| α-helix | 401-403 | 3 | |
| α-helix | 404-425 | 22 | |
| α-helix | 433-456 | 24 | |
| α-helix | 461-477 | 17 | |
| α-helix | 487-492 | 6 | |
| α-helix | 503-505 | 3 | |
| α-helix | 512-520 | 9 | |
| α-helix | 535-539 | 5 | |
| α-helix | 549-561 | 13 | |
| α-helix | 576-579 | 4 | |
| α-helix | 583-592 | 10 | |
| α-helix | 597-608 | 12 | |
| α-helix | 618-625 | 8 | |
Chain C: 38 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-25 | 16 | |
| α-helix | 32-45 | 14 | |
| α-helix | 54-77 | 24 | |
| α-helix | 83-104 | 22 | |
| α-helix | 106-107 | 2 | |
| α-helix | 108-113 | 6 | |
| α-helix | 139-147 | 9 | |
| α-helix | 148-152 | 5 | |
| α-helix | 156-172 | 17 | |
| α-helix | 178-190 | 13 | |
| α-helix | 191-194 | 4 | |
| α-helix | 201-203 | 3 | |
| α-helix | 204-208 | 5 | |
| α-helix | 209-227 | 19 | |
| α-helix | 232-251 | 20 | |
| α-helix | 256-259 | 4 | |
| α-helix | 262-270 | 9 | |
| α-helix | 275-288 | 14 | |
| α-helix | 291-301 | 11 | |
| α-helix | 308-327 | 20 | |
| α-helix | 335-356 | 22 | |
| α-helix | 362-376 | 15 | |
| α-helix | 387-399 | 13 | |
| β-strand | 400 | 1 | 1 |
| α-helix | 408-422 | 15 | |
| α-helix | 428-444 | 17 | |
| β-strand | 448 | 1 | 1 |
| α-helix | 451-469 | 19 | |
| α-helix | 472-493 | 22 | |
| β-strand | 506-507 | 2 | 2 |
| β-strand | 510-513 | 4 | 3 |
| α-helix | 531-547 | 17 | |
| β-strand | 551-555 | 5 | 3 |
| β-strand | 561-565 | 5 | 2 |
| β-strand | 574-578 | 5 | 2 |
| α-helix | 579-581 | 3 | |
| α-helix | 582-590 | 9 | |
| β-strand | 593-594 | 2 | 4 |
| α-helix | 597-599 | 3 | |
| α-helix | 600-603 | 4 | |
| α-helix | 607-618 | 12 | |
| β-strand | 623-625 | 3 | 4 |
| β-strand | 638-640 | 3 | 4 |
| β-strand | 650-652 | 3 | 2 |
| α-helix | 655-658 | 4 | |
| α-helix | 660-661 | 2 | |
| α-helix | 662-691 | 30 | |
| β-strand | 693-695 | 3 | 5 |
| α-helix | 696-706 | 11 | |
| α-helix | 715-727 | 13 | |
| β-strand | 731-733 | 3 | 5 |
| β-strand | 740-743 | 4 | 5 |
Chain D: 37 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-14 | 12 | |
| α-helix | 17-23 | 7 | |
| α-helix | 29-35 | 7 | |
| β-strand | 41-42 | 2 | 6 |
| β-strand | 45-46 | 2 | 6 |
| α-helix | 49-56 | 8 | |
| α-helix | 59-64 | 6 | |
| α-helix | 65-69 | 5 | |
| β-strand | 77-80 | 4 | 7 |
| β-strand | 85-89 | 5 | 7 |
| α-helix | 91-98 | 8 | |
| α-helix | 101-109 | 9 | |
| α-helix | 124-130 | 7 | |
| α-helix | 134-141 | 8 | |
| α-helix | 157-163 | 7 | |
| α-helix | 168-174 | 7 | |
| α-helix | 190-197 | 8 | |
| α-helix | 200-208 | 9 | |
| α-helix | 222-228 | 7 | |
| α-helix | 234-240 | 7 | |
| α-helix | 246-251 | 6 | |
| α-helix | 255-261 | 7 | |
| α-helix | 270-283 | 14 | |
| α-helix | 296-299 | 4 | |
| α-helix | 311-316 | 6 | |
| α-helix | 321-336 | 16 | |
| α-helix | 341-343 | 3 | |
| α-helix | 344-355 | 12 | |
| α-helix | 361-377 | 17 | |
| α-helix | 382-397 | 16 | |
| α-helix | 404-426 | 23 | |
| α-helix | 433-456 | 24 | |
| α-helix | 461-476 | 16 | |
| α-helix | 487-491 | 5 | |
| α-helix | 502-505 | 4 | |
| α-helix | 512-520 | 9 | |
| α-helix | 535-539 | 5 | |
| α-helix | 549-561 | 13 | |
| α-helix | 583-591 | 9 | |
| α-helix | 597-607 | 11 | |
| α-helix | 618-626 | 9 | |
Chain E: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 18-19 | 2 | 8 |
| β-strand | 20-22 | 3 | 9 |
| β-strand | 28 | 1 | 9 |
| β-strand | 29-30 | 2 | 10 |
| β-strand | 31-32 | 2 | 8 |
| α-helix | 33-36 | 4 | |
| α-helix | 40-46 | 7 | |
| β-strand | 59-61 | 3 | 9 |
| α-helix | 67-83 | 17 | |
| α-helix | 90-93 | 4 | |
| α-helix | 103-109 | 7 | |
Chain F: 4 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-8 | 6 | 10 |
| β-strand | 13-18 | 6 | 10 |
| β-strand | 23 | 1 | 11 |
| α-helix | 24-35 | 12 | |
| β-strand | 45 | 1 | 10 |
| β-strand | 50 | 1 | 10 |
| β-strand | 56 | 1 | 11 |
| α-helix | 57-60 | 4 | |
| α-helix | 72 | 1 | |
| β-strand | 73-76 | 4 | 10 |
| α-helix | 90-99 | 10 | |
Chain G: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 18-19 | 2 | 16 |
| β-strand | 20-22 | 3 | 17 |
| β-strand | 28 | 1 | 17 |
| β-strand | 31-32 | 2 | 16 |
| α-helix | 33-36 | 4 | |
| α-helix | 40-46 | 7 | |
| β-strand | 59-61 | 3 | 17 |
| α-helix | 67-82 | 16 | |
| α-helix | 90-93 | 4 | |
| α-helix | 103-109 | 7 | |
Chain H: 5 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-8 | 6 | 18 |
| β-strand | 13-18 | 6 | 18 |
| β-strand | 23 | 1 | 19 |
| α-helix | 24-35 | 12 | |
| α-helix | 39-41 | 3 | |
| β-strand | 42-45 | 4 | 18 |
| β-strand | 50 | 1 | 18 |
| β-strand | 56 | 1 | 19 |
| α-helix | 57-60 | 4 | |
| α-helix | 72 | 1 | |
| β-strand | 73-79 | 7 | 18 |
| α-helix | 94-99 | 6 | |
4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Cullin-2 | A, C | protein | 750 | Homo sapiens | Q13617 (AlphaFold model) |
| Protein fem-1 homolog B | B, D | protein | 627 | Homo sapiens | Q9UK73 (AlphaFold model) |
| Elongin-C | E, G | protein | 96 | Homo sapiens | Q15369 (AlphaFold model) |
| Elongin-B | F, H | protein | 118 | Homo sapiens | Q15370 (AlphaFold model) |
| E3 ubiquitin-protein ligase RBX1, N-terminally processed | I, J | protein | 96 | Homo sapiens | P62877 |
| Coiled-coil domain-containing protein 89 | K, L | protein | 31 | Homo sapiens | Q8N998 |
Sequence of entity 1 (A, C), FASTA
>8WQA_1 Cullin-2 (chains A, C)
SASWSHPQFEKGGGSGGGSGTSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFS
DIYALCVAYPEPLGERLYTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADY
MDCLYRYLNTQFIKKNGGGPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGED
PNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQY
MEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMA
NMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLIN
TVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRL
TSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHR
MYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEK
SVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVS
YKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITT
SMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSI
SMIKKCIEVLIDKQYIERSQASADEYSYVA
Sequence of entity 2 (B, D), FASTA
>8WQA_2 Protein fem-1 homolog B (chains B, D)
MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAK
VVRLLLEHYRVQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVT
NSTPLRAACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADP
NAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELLLS
HADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIH
AYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYRGAVYADNMEF
EQCIKLWLHALHLRQKGNRNTHKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQ
SMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPR
TREGFTLLHLAVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIV
QYNRPISDFLTLHSIIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCL
AARAVRANDINYQDQIPRTLEEFVGFH
Sequence of entity 3 (E, G), FASTA
>8WQA_3 Elongin-C (chains E, G)
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY
FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Sequence of entity 4 (F, H), FASTA
>8WQA_4 Elongin-B (chains F, H)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Sequence of entity 5 (I, J), FASTA
>8WQA_5 E3 ubiquitin-protein ligase RBX1, N-terminally processed (chains I, J)
SHMGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAW
GVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Sequence of entity 6 (K, L), FASTA
>8WQA_6 Coiled-coil domain-containing protein 89 (chains K, L)
GGGSGGGSKKHSLDLLSKERELNGKLRHLSP
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 6 |
Primary citation
Mechanism of Psi-Pro/C-degron recognition by the CRL2 FEM1B ubiquitin ligase. Chen, X., Raiff, A., Li, S. et al. Nat Commun (2024) 15:3558-3558. DOI 10.1038/s41467-024-47890-5 · PubMed
Other PDB entries of the same protein (UniProt Q13617 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7PLO 2.8 Å, H. sapiens replisome-CUL2/LRR1 complex
- 9EFQ 2.96 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-2
- 4WQO 3.2 Å, Structure of VHL-EloB-EloC-Cul2
- 8JAU 3.22 Å, Structure of CRL2APPBP2 bound with the C-degron of MRPL28 (dimer)
- 8JAQ 3.26 Å, Structure of CRL2APPBP2 bound with RxxGP degron (tetramer)
- 8WQF 3.27 Å, cryo-EM structure of CUL2-RBX1-ELOB-ELOC-FEM1B bound with the C-degron of CUX1…
- 9UA3 3.28 Å, Cryo-EM structure of neddylated CUL2-RBX1-FEM1C-ELOB-ELOC
- 8JAL 3.3 Å, Structure of CRL2APPBP2 bound with RxxGP degron (dimer)
- 8JAR 3.3 Å, Structure of CRL2APPBP2 bound with RxxGPAA degron (dimer)
- 8WQB 3.37 Å, Cryo-EM structure of CUL2-RBX1-ELOB-ELOC-FEM1B bound with the C-degron of CCDC89…
- 8WQE 3.38 Å, Cryo-EM structure of CUL2-RBX1-ELOB-ELOC-FEM1B bound with the C-degron of CUX1…
- 8JAV 3.44 Å, Structure of CRL2APPBP2 bound with the C-degron of MRPL28 (tetramer)
Browse structure collections
About this viewer
MolViewer shows 8WQA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.