8WU1: CB1-beta-arrestin1 complex

Cryo-EM structure of CB1-beta-arrestin1 complex. Determined by electron microscopy at 3.2 Å resolution. Released 20 Mar 2024.

Method: Electron microscopy
Resolution: 3.2 Å
Organisms: Bos taurus, Homo sapiens
Chains: 4
Atoms: 7,250
Mol. weight: 143.93 kDa
Ligands: KCA
Released: 20 Mar 2024

Explore 8WU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WU1 contains 26 α-helices and 70 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 7 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	19-22	4	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	37-42	6	1
β-strand	52-61	10	4
β-strand	77-87	11	4
α-helix	99-107	9
β-strand	112-117	6	1
β-strand	128-129	2	5
α-helix	139	1
β-strand	143-151	9	4
α-helix	160-162	3
β-strand	163-166	4	4
β-strand	169-171	3	2
α-helix	180-182	3
β-strand	183-188	6	6
β-strand	197-203	7	6
β-strand	207-209	3	7
β-strand	214-222	9	6
β-strand	228-241	14	8
β-strand	251-258	8	8
β-strand	262	1	8
β-strand	266-274	9	6
α-helix	287	1
β-strand	288-289	2	5
β-strand	300	1	5
α-helix	301-303	3
α-helix	306-307	2
β-strand	317-329	13	8
β-strand	343-349	7	8
β-strand	350-352	3	7

Chain H: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	9
β-strand	15	1	10
β-strand	20-26	7	9
β-strand	35-42	8	11
β-strand	48-55	8	11
β-strand	60-63	4	11
α-helix	65-67	3
β-strand	71-76	6	9
β-strand	81-87	7	9
α-helix	91-93	3
β-strand	95-103	9	11
β-strand	110-113	4	11
β-strand	117-119	3	11
β-strand	121	1	10
α-helix	124-126	3
β-strand	127	1	12
β-strand	130-133	4	13
β-strand	149-155	7	13
β-strand	156	1	12
β-strand	160-164	5	14
α-helix	165-167	3
β-strand	173-180	8	13
β-strand	186-192	7	13
β-strand	205-210	6	14
β-strand	215-220	6	14

Chain L: 3 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	15
β-strand	12-14	3	16
β-strand	20-26	7	15
β-strand	34-35	2	17
β-strand	36-37	2	18
β-strand	38-39	2	19
β-strand	47-50	4	18
β-strand	54-55	2	18
β-strand	63-68	6	15
β-strand	71-76	6	15
β-strand	86-87	2	19
β-strand	90-91	2	17
α-helix	97	1
β-strand	98-99	2	17
β-strand	103-104	2	19
β-strand	105-107	3	16
β-strand	112	1	20
β-strand	117-119	3	21
α-helix	120-122	3
β-strand	132-138	7	21
β-strand	141	1	20
β-strand	159-161	3	21
β-strand	164	1	21
β-strand	175-181	7	21
α-helix	184-186	3

Chain R: 12 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	113-140	28
α-helix	146-149	4
α-helix	151-175	25
α-helix	176-180	5
α-helix	188-219	32
α-helix	223-227	5
α-helix	230-249	20
α-helix	250-252	3
α-helix	274-308	35
α-helix	341-368	28
α-helix	375-398	24
α-helix	402-407	6
β-strand	433-436	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	C	protein	393	Bos taurus	P17870 (AlphaFold model)
Fab30 heavy chain	H	protein	238	Homo sapiens
Fab30 light chain	L	protein	215	Homo sapiens
Cannabinoid receptor 1,Vasopressin V2 receptor	R	protein	443	Homo sapiens	P21554 (AlphaFold model), P30518 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>8WU1_1 Beta-arrestin-1 (chains C)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLIELDTNDDDAAAEDFAR

Sequence of entity 2 (H), FASTA

>8WU1_2 Fab30 heavy chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHHH

Sequence of entity 3 (L), FASTA

>8WU1_3 Fab30 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (R), FASTA

>8WU1_4 Cannabinoid receptor 1,Vasopressin V2 receptor (chains R)
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPCARGRTP
PSLGPQDESCTTASSSLAKDTSS

Ligands and cofactors

ID	Name	Formula	Copies
KCA	methyl N-{1-[(4-fluorophenyl)methyl]-1H-indazole-3-carbonyl}-3-methyl-L-valinate	C22 H24 F N3 O3	1

Primary citation

Snapshot of the cannabinoid receptor 1-arrestin complex unravels the biased signaling mechanism. Liao, Y.Y., Zhang, H., Shen, Q. et al. Cell (2023) 186:5784-5797.e17. DOI 10.1016/j.cell.2023.11.017 · PubMed

Other PDB entries of the same protein (UniProt P17870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G4M 1.9 Å, Crystal structure of bovine beta-arrestin 1
1G4R 2.2 Å, Crystal structure of bovine beta-arrestin 1
3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex
22GK 2.84 Å, C5a bound C5aR2 in complex with beta-arrestin1
1JSY 2.9 Å, Crystal structure of bovine arrestin-2
1ZSH 2.9 Å, Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6)
22CR 2.9 Å, C5a-desArg bound C5aR2 in complex with beta-arrestin1

Browse structure collections

About this viewer

MolViewer shows 8WU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.