8WWR: Apo human dishevelled 2 (Dvl2) PDZ domain

Crystal structure of apo human dishevelled 2 (Dvl2) PDZ domain. Determined by X-ray diffraction at 1.75 Å resolution. Released 29 May 2024.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 1
Atoms: 641
Mol. weight: 10.22 kDa
Released: 29 May 2024

Explore 8WWR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WWR contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	265-270	6	1
α-helix	272-274	3
β-strand	280-284	5	1
β-strand	294-299	6	1
α-helix	304-308	5
β-strand	316-320	5	1
β-strand	323-324	2	1
α-helix	330-340	11
β-strand	347-352	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Segment polarity protein dishevelled homolog DVL-2	A	protein	95	Homo sapiens	O14641 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8WWR_1 Segment polarity protein dishevelled homolog DVL-2 (chains A)
SMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQ
VNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKC

Primary citation

Dishevelled2 activates WGEF via its interaction with a unique internal peptide motif of the GEF. Omble, A., Mahajan, S., Bhoite, A. et al. Commun Biol (2024) 7:543-543. DOI 10.1038/s42003-024-06194-6 · PubMed

Other PDB entries of the same protein (UniProt O14641 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CBZ 1.38 Å, The Dvl2 PDZ Domain in Complex with the N2 Inhibitory Peptide
3CBY 1.5 Å, The Dvl2 PDZ Domain in Complex with the N1 Inhibitory Peptide
2REY 1.55 Å, Crystal structure of the PDZ domain of human dishevelled 2 (homologous to Drosophila dsh)
6IW3 1.64 Å, High resolution structure of Dvl2-DIX Y27W/C80S mutant
3CBX 1.7 Å, The Dvl2 PDZ Domain in Complex with the C1 Inhibitory Peptide
3CC0 1.75 Å, The Dvl2 PDZ Domain in Complex with the N3 Inhibitory Peptide
5SUZ 1.84 Å, Domain-swapped dimer of human Dishevelled2 DEP domain: C-centered monoclinic crystal…
5SUY 1.88 Å, Domain-swapped dimer of human Dishevelled2 DEP domain: monoclinic crystal form…
35UG 1.95 Å, Human DVL2 PDZ domain in complex with Vangl2
5LNP 1.99 Å, Domain-swapped dimer of human Dishevelled2 DEP domain: monoclinic crystal form…
4WIP 2.69 Å, DIX domain of human Dvl2
8YR7 3.0 Å, Crystal structure of human dishevelled 2 (Dvl2) PDZ domain fused with WGEF internal…

Browse structure collections

About this viewer

MolViewer shows 8WWR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.