8X0W: Overall structure of the LAT1-4F2hc

Overall structure of the LAT1-4F2hc bound with Leu. Determined by electron microscopy at 3.1 Å resolution. Released 13 Nov 2024.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,368
Mol. weight: 104.5 kDa
Ligands: LEU
Released: 13 Nov 2024

Explore 8X0W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8X0W contains 50 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	167-173	7
α-helix	177-206	30
α-helix	209-211	3
α-helix	219-221	3
β-strand	225-229	5	1
α-helix	231-235	5
α-helix	242-248	7
α-helix	249-255	7
β-strand	261-262	2	1
α-helix	263-264	2
β-strand	266	1	2
α-helix	280	1
β-strand	281	1	2
α-helix	282	1
α-helix	288-301	14
β-strand	306-308	3	1
α-helix	325-341	17
β-strand	346-349	4	1
α-helix	351-353	3
α-helix	357-371	15
β-strand	377-380	4	1
α-helix	386-392	7
β-strand	400-402	3	1
α-helix	413-427	15
β-strand	433-434	2	3
α-helix	442-444	3
α-helix	451-458	8
β-strand	464-465	2	3
β-strand	466-468	3	1
α-helix	488-490	3
α-helix	506-508	3
α-helix	510-513	4
α-helix	520-533	14
α-helix	535-539	5
β-strand	543-544	2	4
β-strand	551-556	6	4
β-strand	563-569	7	4
β-strand	575-576	2	5
α-helix	586-588	3
β-strand	593-594	2	6
β-strand	595	1	4
β-strand	610-611	2	6
β-strand	616-617	2	5
α-helix	618	1
β-strand	622-627	6	4

Chain B: 25 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	50	1	7
α-helix	52-63	12
α-helix	67-79	13
α-helix	82-109	28
α-helix	118-123	6
α-helix	127-135	9
α-helix	136-140	5
α-helix	141-156	16
α-helix	165-167	3
α-helix	168-188	21
α-helix	191-220	30
α-helix	240-253	14
α-helix	259-261	3
β-strand	267	1	7
α-helix	270-297	28
α-helix	302-307	6
α-helix	311-320	10
α-helix	326-354	29
α-helix	374-385	12
α-helix	386-388	3
α-helix	394-397	4
α-helix	401-421	21
α-helix	435-452	18
α-helix	456-466	11
α-helix	468-472	5
α-helix	473-477	5
α-helix	483-500	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amino acid transporter heavy chain SLC3A2	A	protein	470	Homo sapiens	P08195 (AlphaFold model)
Large neutral amino acids transporter small subunit 1	B	protein	464	Homo sapiens	Q01650 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8X0W_1 Amino acid transporter heavy chain SLC3A2 (chains A)
FTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWH
TGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQI
DPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQA
GVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLL
TSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTL
PGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLL
SLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQA
SDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA

Sequence of entity 2 (B), FASTA

>8X0W_2 Large neutral amino acids transporter small subunit 1 (chains B)
VTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCY
AELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPT
CPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIGKGD
VSNLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLP
IVTLVYVLTNLAYFTTLSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSL
FTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFF
NWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFT
IILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQET

Ligands and cofactors

ID	Name	Formula	Copies
LEU	Leucine	C6 H13 N O2	1

Primary citation

Structural insights into the substrate transport mechanism of the amino acid transporter complex. Yang, H., Shi, T., Dong, J. et al. J Biol Chem (2025) 301:110569-110569. DOI 10.1016/j.jbc.2025.110569 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8A6L 3.18 Å, Human 4F2hc-LAT2 heterodimeric amino acid transporter in complex with anticalin D11vs

Browse structure collections

About this viewer

MolViewer shows 8X0W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.