8X1N: Human alpha-fetoprotein

Cryo-EM structure of human alpha-fetoprotein. Determined by electron microscopy at 3.31 Å resolution. Released 15 May 2024.

Method: Electron microscopy
Resolution: 3.31 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,763
Mol. weight: 70.44 kDa
Ligands: PLM, ZN
Released: 15 May 2024

Explore 8X1N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8X1N contains 31 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 0 β-strands

Element	Residues	Length
α-helix	43-54	12
α-helix	60-74	15
α-helix	86-89	4
α-helix	91-98	8
α-helix	102-108	7
α-helix	118-127	10
α-helix	147-153	7
α-helix	155-169	15
α-helix	175-192	18
α-helix	198-246	49
α-helix	252-270	19
α-helix	274-290	17
α-helix	297-302	6
α-helix	307-316	10
α-helix	317-319	3
α-helix	321-323	3
α-helix	344-361	18
α-helix	367-384	18
α-helix	390-400	11
α-helix	403-422	20
α-helix	424-438	15
α-helix	444-461	18
α-helix	468-490	23
α-helix	495-501	7
α-helix	508-512	5
α-helix	523-526	4
α-helix	528-531	4
α-helix	536-539	4
α-helix	543-559	17
α-helix	565-583	19
α-helix	588-607	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-fetoprotein	A	protein	609	Homo sapiens	P02771 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8X1N_1 Alpha-fetoprotein (chains A)
MKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATY
KEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEG
RHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILL
WAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSLLNQHACAVMKNFGTRTFQAITV
TKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKIT
ECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSR
RHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQ
KLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADII
IGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQA
QGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLI
SKTRAALGV

Ligands and cofactors

ID	Name	Formula	Copies
PLM	Palmitic acid	C16 H32 O2	4
ZN	Zinc ion	Zn	1

Primary citation

Structural characteristics of alpha-fetoprotein, including N-glycosylation, metal ion and fatty acid binding sites. Liu, K., Wu, C., Zhu, M. et al. Commun Biol (2024) 7:505-505. DOI 10.1038/s42003-024-06219-0 · PubMed

Other PDB entries of the same protein (UniProt P02771 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MRK 1.4 Å, Crystal Structure of MHC class I HLA-A2 molecule complexed with AFP137 nonapeptide
7RE7 2.55 Å, TCR mimic antibody (Fab fragment) in complex with AFP/HLA-A*02
7YIM 2.6 Å, Cryo-EM structure of human Alpha-fetoprotein
7RE8 2.82 Å, Class I MHC (HLA-A*02) presenting alpha fetoprotein peptide (AFP)

Browse structure collections

About this viewer

MolViewer shows 8X1N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.