8X29: Hemagglutinin

Crystal structure of H5 hemagglutinin from swan-infecting H5N8 influenza virus in complex with LSTa. Determined by X-ray diffraction at 2.61 Å resolution. Released 14 May 2025.

Method: X-ray diffraction
Resolution: 2.61 Å
Organism: Influenza A virus
Chains: 3
Atoms: 12,385
Mol. weight: 176.26 kDa
Ligands: NAG, GAL, SIA
Released: 14 May 2025

Explore 8X29 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8X29 contains 43 α-helices and 143 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 48 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	8	1	2
β-strand	15-16	2	3
β-strand	24-25	2	3
β-strand	26	1	4
β-strand	29-31	3	5
β-strand	33-34	2	6
β-strand	41-44	4	7
β-strand	47	1	7
β-strand	50-51	2	8
β-strand	55	1	9
α-helix	57-62	6
α-helix	65-70	6
β-strand	79-81	3	8
β-strand	87	1	9
β-strand	93-95	3	10
α-helix	98-105	8
β-strand	108-115	8	10
α-helix	119-121	3
β-strand	126	1	11
β-strand	132-137	6	12
β-strand	140-142	3	12
β-strand	147-149	3	10
β-strand	151	1	11
β-strand	153	1	13
β-strand	156	1	13
α-helix	158-159	2
β-strand	160-165	6	14
β-strand	172-180	9	10
α-helix	184-191	8
β-strand	198-201	4	14
β-strand	206-209	4	14
β-strand	219	1	15
β-strand	222	1	15
β-strand	225-233	9	10
α-helix	234	1
β-strand	238-243	6	14
β-strand	247-250	4	10
β-strand	252-259	8	10
β-strand	264-266	3	8
α-helix	269-270	2
β-strand	271-276	6	7
β-strand	278-281	4	16
β-strand	283-284	2	16
β-strand	291-292	2	6
β-strand	299-300	2	16
α-helix	303	1
β-strand	304-305	2	6
β-strand	312-314	3	5
α-helix	317	1
β-strand	318	1	4
α-helix	319-320	2
β-strand	335	1	17
β-strand	339	1	17
β-strand	343	1	2
β-strand	351-357	7	1
β-strand	360-365	6	1
α-helix	367-387	21
α-helix	404-455	52
α-helix	456-458	3
β-strand	459-461	3	1
β-strand	466-469	4	1
α-helix	475-482	8
α-helix	489-498	10

Chain B: 12 helices, 48 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	18
β-strand	8	1	19
β-strand	15-16	2	20
β-strand	24-25	2	20
β-strand	26	1	21
β-strand	29-31	3	22
β-strand	33-34	2	23
β-strand	41-44	4	24
β-strand	47	1	24
β-strand	50-51	2	25
β-strand	55	1	26
α-helix	57-62	6
α-helix	65-70	6
β-strand	79-81	3	25
β-strand	87	1	26
β-strand	93-95	3	27
α-helix	98-105	8
β-strand	108-115	8	27
α-helix	119-121	3
β-strand	126	1	28
β-strand	132-137	6	29
β-strand	140-142	3	29
β-strand	147-149	3	27
β-strand	151	1	28
β-strand	153	1	30
β-strand	156	1	30
α-helix	158-159	2
β-strand	160-165	6	31
β-strand	172-180	9	27
α-helix	184-190	7
β-strand	198-201	4	31
β-strand	206-209	4	31
β-strand	219	1	32
β-strand	222	1	32
β-strand	225-233	9	27
β-strand	238-243	6	31
β-strand	247-250	4	27
β-strand	252-259	8	27
β-strand	264-266	3	25
α-helix	269-270	2
β-strand	271-276	6	24
β-strand	278-280	3	33
β-strand	283-285	3	33
β-strand	291-292	2	23
β-strand	299-300	2	33
β-strand	304-305	2	23
β-strand	312-314	3	22
β-strand	318	1	21
α-helix	319-320	2
β-strand	335	1	34
β-strand	339	1	34
β-strand	343	1	19
β-strand	351-357	7	18
β-strand	360-365	6	18
α-helix	367-386	20
α-helix	404-455	52
β-strand	459-461	3	18
β-strand	466-469	4	18
α-helix	475-483	9
α-helix	488-498	11

Chain C: 15 helices, 47 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	35
β-strand	8	1	36
β-strand	15-16	2	37
β-strand	24-25	2	37
β-strand	26	1	38
β-strand	29-31	3	39
β-strand	33-34	2	40
β-strand	41-44	4	41
α-helix	48-49	2
β-strand	50-51	2	42
β-strand	55	1	43
α-helix	57-62	6
α-helix	65-70	6
β-strand	79-81	3	42
β-strand	87	1	43
β-strand	93-95	3	44
α-helix	98-105	8
β-strand	108-115	8	44
α-helix	119-121	3
β-strand	126	1	45
β-strand	132-137	6	46
β-strand	140-142	3	46
β-strand	147-149	3	44
β-strand	151	1	45
α-helix	158-159	2
β-strand	160-165	6	47
β-strand	172-180	9	44
α-helix	184-190	7
β-strand	198-201	4	47
β-strand	206-209	4	47
β-strand	219	1	48
β-strand	222	1	48
β-strand	225-233	9	44
β-strand	238-243	6	47
β-strand	247-250	4	44
β-strand	252-259	8	44
β-strand	264-266	3	42
α-helix	269-270	2
β-strand	271-276	6	41
β-strand	278-280	3	49
β-strand	283-284	2	49
β-strand	291-292	2	40
β-strand	299-300	2	49
α-helix	303	1
β-strand	304-305	2	40
β-strand	312-314	3	39
α-helix	317	1
β-strand	318	1	38
α-helix	319-320	2
β-strand	335	1	50
β-strand	339	1	50
β-strand	343	1	36
β-strand	351-354	4	35
β-strand	357	1	51
β-strand	360	1	51
β-strand	363-365	3	35
α-helix	367-387	21
α-helix	404-455	52
β-strand	459-461	3	35
β-strand	466-469	4	35
α-helix	475-483	9
α-helix	489-499	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hemagglutinin	A, B, C	protein	506	Influenza A virus	A0A8E4ZAK5

Sequence of entity 1 (A, B, C), FASTA

>8X29_1 Hemagglutinin (chains A, B, C)
DQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILKDCSVAGW
LLGNPMCDEFIRVPEWSYIVERANPVNDLCYPGSLNDYEELKHLLSRINHFEKILIIPKS
SWPNHETSLGVSAACPYQGAPSFFRNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHH
SNNAEEQINLYKNPTTYISVGTSTLNQRLVPKIATRSQVNGQRGRMDFFWTILKPDDAIH
FESNGNFIAPEYAYKIVKKGDSTIMKSGVEYGNCNTKCQTPVGAINSSMPFHNIHPLTIG
ECPKYVKSNKLVLATGLRNSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQG
SGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDV
WTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMES
VRNGTYDYPQYSEEARLKREEISGVK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	12
GAL	beta-D-galactopyranose	C6 H12 O6	1
SIA	N-acetyl-alpha-neuraminic acid	C11 H19 N O9	1

Primary citation

Hemagglutinin double-mutation enhances binding of human-infecting avian influenza virus clade 2.3.4.4b H5Ny to human and SLe X receptors. Jin, X., Han, P., Wang, Y. et al. EMBO Rep (2026). DOI 10.1038/s44319-026-00816-2 · PubMed

Other PDB entries of the same protein (UniProt A0A8E4ZAK5), best resolution first:

8X2D 2.48 Å, Crystal structure of H5 hemagglutinin from swan-infecting H5N8 influenza virus complexed…
8X2C 2.59 Å, Crystal structure of H5 hemagglutinin from swan-infecting H5N8 influenza virus
8X2F 2.62 Å, Cryo-EM structure of H5 hemagglutinin from human-infecting H5N8 influenza virus in…
9EKF 2.68 Å, CryoEM structure of H5N1 A/Texas/37/2024 HA bound to Fab 65C6 and an auto glycan…
9DIO 2.7 Å, Crystal structure of H5 hemagglutinin Q226L mutant from the influenza virus…
8ZDV 2.8 Å, The cryoEM structure of H5N8 HA in an auto inhibited state
9DWE 2.8 Å, Cryo-EM structure of hemagglutinin H5 A/Texas/37/2024 in complex with LSTa and antibody…
9JN0 2.84 Å, Cryo-EM structure of a human-infecting bovine influenza H5N1 hemagglutinin complexed…
9JMZ 2.91 Å, Cryo-EM structure of a human-infecting bovine influenza H5N1 hemagglutinin complexed…
9N7T 3.01 Å, H5 hemagglutinin (A/Jiangsu/NJ210/2023) in complex with central stem-targeting Fab ST14
8X27 3.04 Å, Crystal structure of H5 hemagglutinin from human-infecting H5N8 influenza virus in…
9MQ2 3.06 Å, Cryo-EM map of H5 HA (A/Jiangsu/NJ210/2023) in complex with monoclonal fab 12G1

Browse structure collections

About this viewer

MolViewer shows 8X29 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.