The cryoEM structure of H5N8 HA in an auto inhibited state. Determined by electron microscopy at 2.8 Å resolution. Released 25 Sept 2024.
Explore 8ZDV in 3D Show helices and sheets RCSB PDB PDBe
8ZDV contains 42 α-helices and 144 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-13 | 2 | 17 |
| β-strand | 15-17 | 3 | 18 |
| β-strand | 18 | 1 | 19 |
| β-strand | 24-28 | 5 | 20 |
| β-strand | 31-36 | 6 | 20 |
| β-strand | 39-41 | 3 | 21 |
| β-strand | 43-44 | 2 | 22 |
| β-strand | 51 | 1 | 23 |
| β-strand | 54 | 1 | 24 |
| β-strand | 56 | 1 | 24 |
| β-strand | 59-60 | 2 | 25 |
| β-strand | 64 | 1 | 26 |
| α-helix | 66-71 | 6 | |
| β-strand | 87-89 | 3 | 25 |
| β-strand | 95 | 1 | 26 |
| β-strand | 100-102 | 3 | 27 |
| α-helix | 105-112 | 8 | |
| β-strand | 117-121 | 5 | 27 |
| α-helix | 125A-126 | 3 | |
| β-strand | 131 | 1 | 28 |
| β-strand | 136-141 | 6 | 29 |
| β-strand | 144-146 | 3 | 29 |
| β-strand | 151-153 | 3 | 27 |
| β-strand | 155 | 1 | 28 |
| α-helix | 162-163 | 2 | |
| β-strand | 164-168 | 5 | 30 |
| β-strand | 176-184 | 9 | 27 |
| α-helix | 188-194 | 7 | |
| β-strand | 202-205 | 4 | 30 |
| β-strand | 210-213 | 4 | 30 |
| β-strand | 223 | 1 | 31 |
| β-strand | 226 | 1 | 31 |
| β-strand | 229-237 | 9 | 27 |
| α-helix | 238 | 1 | |
| β-strand | 243-247 | 5 | 30 |
| β-strand | 251-254 | 4 | 27 |
| β-strand | 257-261 | 6 | 27 |
| β-strand | 267-269 | 3 | 25 |
| α-helix | 272-273 | 2 | |
| β-strand | 274 | 1 | 23 |
| β-strand | 279 | 1 | 24 |
| β-strand | 281-282 | 2 | 32 |
| β-strand | 287 | 1 | 32 |
| β-strand | 294-295 | 2 | 22 |
| β-strand | 302-303 | 2 | 32 |
| α-helix | 306 | 1 | |
| β-strand | 307-308 | 2 | 22 |
| β-strand | 315-317 | 3 | 21 |
| β-strand | 321 | 1 | 20 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14 | 1 | 3 |
| β-strand | 22-24 | 3 | 2 |
| β-strand | 26 | 1 | 49 |
| β-strand | 27 | 1 | 1 |
| β-strand | 33 | 1 | 49 |
| α-helix | 38-59 | 22 | |
| α-helix | 72-74 | 3 | |
| α-helix | 75-126 | 52 | |
| α-helix | 127-129 | 3 | |
| β-strand | 130-132 | 3 | 1 |
| β-strand | 138-140 | 3 | 1 |
| α-helix | 146-154 | 9 | |
| α-helix | 159-169 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hemagglutinin | A, B, C | protein | 336 | Influenza A virus | A0A8E4ZAK5 |
| Hemagglutinin | G, H, I | protein | 190 | Influenza A virus | A0A8K1DYS3 |
>8ZDV_1 Hemagglutinin (chains A, B, C) MENIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDL NGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPSNDLCYPGSLNDYEELKHL LSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGAPSFFRNVVWLIKKNDAYPTIKISY NNTNQEDLLILWGIHHSNNAEEQTNLYKNPTTYISVGTSTLNQRLVPKIATRSQVNGQRG RMDFFWTILKPDDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSGVEYGHCNTKCQTPVGA INSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRNS
>8ZDV_2 Hemagglutinin (chains G, H, I) PLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNK VNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFH DSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYSGEARLKRE EISGVKLESI
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 12 |
Multivalent interactions between fully glycosylated influenza virus hemagglutinins mediated by glycans at distinct N-glycosylation sites. Li, R., Gao, J., Wang, L. et al. Npj Viruses (2024) 2:48-48. DOI 10.1038/s44298-024-00059-9 · PubMed
Other PDB entries of the same protein (UniProt A0A8E4ZAK5), best resolution first:
MolViewer shows 8ZDV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.