8X8K: STBD1 CBM20 domain

Crystal structure of STBD1 CBM20 domain in complex with maltotetraose. Determined by X-ray diffraction at 2.1 Å resolution. Released 18 Sept 2024.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,589
Mol. weight: 50.46 kDa
Released: 18 Sept 2024

Explore 8X8K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8X8K contains 11 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	263-271	9	1
β-strand	280-285	6	2
α-helix	288-290	3
β-strand	297-298	2	2
β-strand	300-301	2	1
α-helix	303-305	3
β-strand	306-314	9	1
β-strand	318-327	10	2
β-strand	330-334	5	2
α-helix	338-339	2
β-strand	340-343	4	2
β-strand	349-352	4	1
β-strand	354	1	3
β-strand	357	1	3

Chain B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	263-271	9	4
β-strand	280-285	6	5
α-helix	288-290	3
β-strand	297-298	2	5
β-strand	300-301	2	4
β-strand	306-314	9	4
β-strand	318-327	10	5
β-strand	330-334	5	5
α-helix	338-339	2
β-strand	340-343	4	5
β-strand	349-353	5	4
β-strand	354	1	6
β-strand	357	1	6

Chain C: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	263-271	9	7
β-strand	279-285	7	8
α-helix	288-293	6
β-strand	297-298	2	8
β-strand	300-303	4	7
β-strand	306-314	9	7
β-strand	318-327	10	8
β-strand	330-334	5	8
α-helix	339	1
β-strand	340-343	4	8
β-strand	349-352	4	7
β-strand	354	1	9
β-strand	357	1	9

Chain D: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	263-271	9	10
β-strand	279-285	7	11
α-helix	288-290	3
β-strand	297-298	2	11
α-helix	299	1
β-strand	300	1	10
α-helix	301	1
β-strand	306-314	9	10
β-strand	318-327	10	11
β-strand	330-334	5	11
α-helix	338-339	2
β-strand	340-343	4	11
β-strand	349-352	4	10
β-strand	354	1	12
β-strand	357	1	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Starch-binding domain-containing protein 1	A, B, C, D	protein	99	Homo sapiens	O95210 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8X8K_1 Starch-binding domain-containing protein 1 (chains A, B, C, D)
GSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVV
EWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWWGIH

Primary citation

Decoding the molecular mechanism of selective autophagy of glycogen mediated by autophagy receptor STBD1. Zhang, Y., Sun, Y., Shi, J. et al. Proc Natl Acad Sci U S A (2024) 121:e2402817121-e2402817121. DOI 10.1073/pnas.2402817121 · PubMed

Other PDB entries of the same protein (UniProt O95210 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8X8A 1.53 Å, Crystal structure of STBD1 LIR motif in complex with GABARAPL1

Browse structure collections

About this viewer

MolViewer shows 8X8K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.