Crystal structure of STBD1 LIR motif in complex with GABARAPL1. Determined by X-ray diffraction at 1.53 Å resolution. Released 18 Sept 2024.
Explore 8X8A in 3D Show helices and sheets RCSB PDB PDBe
8X8A contains 8 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-8 | 5 | |
| α-helix | 11-24 | 14 | |
| β-strand | 28-35 | 8 | 1 |
| α-helix | 36 | 1 | |
| β-strand | 48-52 | 5 | 1 |
| β-strand | 56 | 1 | 2 |
| α-helix | 57-67 | 11 | |
| β-strand | 77-79 | 3 | 1 |
| β-strand | 80 | 1 | 3 |
| β-strand | 83 | 1 | 3 |
| α-helix | 84-86 | 3 | |
| β-strand | 90 | 1 | 2 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-110 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 202-203 | 2 | |
| β-strand | 204-205 | 2 | 1 |
| α-helix | 206-207 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Gamma-aminobutyric acid receptor-associated protein-like 1 | A | protein | 117 | Homo sapiens | Q9H0R8 (AlphaFold model) |
| Starch-binding domain-containing protein 1 | B | protein | 19 | Homo sapiens | O95210 (AlphaFold model) |
>8X8A_1 Gamma-aminobutyric acid receptor-associated protein-like 1 (chains A) MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
>8X8A_2 Starch-binding domain-containing protein 1 (chains B) GPGSHEEWEMVPRHSGSGS
Decoding the molecular mechanism of selective autophagy of glycogen mediated by autophagy receptor STBD1. Zhang, Y., Sun, Y., Shi, J. et al. Proc Natl Acad Sci U S A (2024) 121:e2402817121-e2402817121. DOI 10.1073/pnas.2402817121 · PubMed
Other PDB entries of the same protein (UniProt Q9H0R8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8X8A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.