8XAG: Chromodomain of Arabidopsis LHP1

Crystal structure of the chromodomain of Arabidopsis LHP1 in complex with histone H3.3K27me3 peptide. Determined by X-ray diffraction at 1.75 Å resolution. Released 4 Dec 2024.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Arabidopsis thaliana
Chains: 4
Atoms: 1,269
Mol. weight: 17.12 kDa
Released: 4 Dec 2024

Explore 8XAG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XAG contains 12 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	102	1
β-strand	103	1	1
α-helix	104	1
β-strand	110-119	10	2
β-strand	122-129	8	2
α-helix	134-136	3
β-strand	138-141	4	2
α-helix	142-145	4
α-helix	148-157	10

Chain B: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	102	1
β-strand	103	1	3
α-helix	104	1
β-strand	110-119	10	4
β-strand	122-129	8	4
α-helix	134-136	3
β-strand	138-141	4	4
α-helix	142-145	4
α-helix	148-156	9

Chains C and D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	28	1	1
α-helix	29-31	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromo domain-containing protein LHP1	A, B	protein	66	Arabidopsis thaliana	Q946J8 (AlphaFold model)
histone H3.3K27me3 peptide	C, D	protein	8	Arabidopsis thaliana	P59169 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8XAG_1 Chromo domain-containing protein LHP1 (chains A, B)
GSERPKLDEGFYEIEAIRRKRVRKGKVQYLIKWRGWPETANTWEPLENLQSIADVIDAFE
GSLKPG

Sequence of entity 2 (C, D), FASTA

>8XAG_2 histone H3.3K27me3 peptide (chains C, D)
ARKSAPTT

Primary citation

Crystal structure of the chromodomain of Arabidopsis LHP1 in complex with histone H3.3K27me3 peptide. Liu, Y., Huang, Y. To be published.

Other PDB entries of the same protein (UniProt Q946J8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7VYW 1.6 Å, Crystal structure of the chromodomain of Arabidopsis LHP1 in complex with methylated…
7VZ2 1.7 Å, Crystal structure of chromodomain of Arabidopsis LHP1

Browse structure collections

About this viewer

MolViewer shows 8XAG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.