8XRP: Interleukin-12 subunit alpha

The Cryo-EM structure of IL-12, receptor subunit beta-1 and receptor subunit beta-2 complex. Determined by electron microscopy at 3.75 Å resolution. Released 24 Jul 2024.

Method: Electron microscopy
Resolution: 3.75 Å
Organism: Homo sapiens
Chains: 16
Atoms: 28,740
Mol. weight: 476.83 kDa
Ligands: NAG
Released: 24 Jul 2024

Explore 8XRP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XRP contains 103 α-helices and 299 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, E, I and M: 6 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	36-58	23
α-helix	81-84	4
α-helix	118-146	29
α-helix	157-170	14
α-helix	176-179	4
β-strand	180-181	2	1
α-helix	188-217	30

Chains B, F, J and N: 6 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	23-27	5	2
β-strand	30-36	7	2
α-helix	41-45	5
β-strand	47-49	3	3
β-strand	59-61	3	4
β-strand	70-71	2	4
β-strand	74-76	3	3
α-helix	82-84	3
β-strand	88-92	5	4
β-strand	95-100	6	4
β-strand	101-108	8	2
β-strand	111-112	2	2
β-strand	117	1	5
β-strand	130-133	4	5
β-strand	139-146	8	5
β-strand	152-153	2	2
β-strand	156-160	5	6
β-strand	168	1	7
β-strand	174-178	5	5
β-strand	187-194	8	5
β-strand	195	1	7
β-strand	208-212	5	6
β-strand	215-216	2	2
β-strand	219-220	2	2
β-strand	223-227	5	6
α-helix	229-232	4
β-strand	233	1	5
α-helix	235-238	4
β-strand	239-245	7	8
α-helix	246	1
β-strand	251-257	7	8
β-strand	271-276	6	9
β-strand	289-291	3	9
β-strand	295-299	5	8
β-strand	305-312	8	9
α-helix	318-322	5
β-strand	323-326	4	9

Chains C, K and O: 11 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	31-34	4	10
β-strand	40-42	3	11
β-strand	47	1	12
β-strand	50-53	4	10
β-strand	67-72	6	11
β-strand	76-80	5	11
β-strand	85-86	2	10
β-strand	89	1	12
α-helix	92-93	2
β-strand	95-104	10	11
α-helix	109-110	2
β-strand	111-121	11	11
α-helix	123-127	5
β-strand	130-133	4	13
β-strand	134-135	2	14
β-strand	142-145	4	13
α-helix	150-151	2
β-strand	156-162	7	15
β-strand	168-173	6	15
β-strand	181-182	2	13
β-strand	186-187	2	16
β-strand	196-203	8	15
β-strand	208-210	3	15
α-helix	211-213	3
β-strand	214-216	3	15
α-helix	218-221	4
β-strand	222-223	2	14
α-helix	224-227	4
β-strand	232-233	2	17
β-strand	242	1	18
β-strand	243-244	2	17
β-strand	245	1	19
β-strand	256-257	2	20
β-strand	269	1	20
β-strand	277	1	19
β-strand	281	1	18
β-strand	292	1	21
β-strand	294-295	2	20
β-strand	297	1	22
α-helix	304	1
β-strand	305	1	22
α-helix	306-309	4
α-helix	311	1
β-strand	312	1	21
α-helix	313	1

Chain D: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	23
α-helix	33-34	2
β-strand	47-56	10	24
β-strand	59-66	8	24
β-strand	75-81	7	23
β-strand	87-88	2	23
β-strand	96-99	4	24
β-strand	111-119	9	23
β-strand	122-125	4	23
α-helix	126-128	3
β-strand	129-131	3	23

Chain G: 11 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	31-34	4	33
β-strand	40-42	3	34
β-strand	47	1	35
β-strand	50-53	4	33
β-strand	67-72	6	34
β-strand	76-80	5	34
β-strand	85-86	2	33
β-strand	89	1	35
α-helix	92-93	2
β-strand	95-104	10	34
α-helix	109-110	2
β-strand	111-121	11	34
α-helix	123-127	5
β-strand	130-133	4	1
β-strand	134-135	2	36
β-strand	140-145	6	1
α-helix	150-151	2
β-strand	156-162	7	37
β-strand	168-173	6	37
β-strand	181-187	7	1
β-strand	196-203	8	37
β-strand	208-210	3	37
α-helix	211-213	3
β-strand	214-216	3	37
α-helix	218-221	4
β-strand	222-223	2	36
α-helix	224-227	4
β-strand	232-233	2	38
β-strand	242	1	39
β-strand	243-244	2	38
β-strand	245	1	40
β-strand	256-257	2	41
β-strand	269	1	41
β-strand	277	1	40
β-strand	281	1	39
β-strand	292	1	42
β-strand	294-295	2	41
β-strand	297	1	43
α-helix	304	1
β-strand	305	1	43
α-helix	306-309	4
α-helix	311	1
β-strand	312	1	42
α-helix	313	1

Chains H, L and P: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	44
α-helix	33-34	2
β-strand	47-56	10	45
β-strand	59-66	8	45
β-strand	75-81	7	44
β-strand	87-88	2	44
β-strand	96-99	4	45
α-helix	101-103	3
β-strand	111-119	9	44
β-strand	122-125	4	44
α-helix	126-128	3
β-strand	129-131	3	44

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 subunit alpha	A, E, I, M	protein	207	Homo sapiens	P29459 (AlphaFold model)
Interleukin-12 subunit beta	B, F, J, N	protein	307	Homo sapiens	P29460 (AlphaFold model)
Interleukin-12 receptor subunit beta-2	C, G, K, O	protein	302	Homo sapiens	Q99665 (AlphaFold model)
Interleukin-12 receptor subunit beta-1	D, H, L, P	protein	219	Homo sapiens	P42701 (AlphaFold model)

Sequence of entity 1 (A, E, I, M), FASTA

>8XRP_1 Interleukin-12 subunit alpha (chains A, E, I, M)
LSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDK
TSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEF
KTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCIL
LHAFRIRAVTIDRVMSYLNASHHHHHH

Sequence of entity 2 (B, F, J, N), FASTA

>8XRP_2 Interleukin-12 subunit beta (chains B, F, J, N)
AIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKE
FGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFT
CWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPA
AEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDT
WSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSE
WASVPCS

Sequence of entity 3 (C, G, K, O), FASTA

>8XRP_3 Interleukin-12 receptor subunit beta-2 (chains C, G, K, O)
KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGH
SLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVAC
TWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAV
NSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSN
SRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEHHHH
HH

Sequence of entity 4 (D, H, L, P), FASTA

>8XRP_4 Interleukin-12 receptor subunit beta-1 (chains D, H, L, P)
CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSS
GRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPL
GDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMN
VAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	12

Primary citation

Structure and assembly of the human IL-12 signaling complex. Chen, H., Ge, X., Li, C. et al. Structure (2024) 32:1640. DOI 10.1016/j.str.2024.07.010 · PubMed

Other PDB entries of the same protein (UniProt P29459 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F45 2.8 Å, Human interleukin-12
3HMX 3.0 Å, Crystal structure of ustekinumab FAB/IL-12 complex
8YI7 3.57 Å, The Cryo-EM structure of IL-12, receptor subunit beta-1 and receptor subunit beta-2…

Browse structure collections

About this viewer

MolViewer shows 8XRP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.