8YI7: Interleukin-12 subunit alpha

The Cryo-EM structure of IL-12, receptor subunit beta-1 and receptor subunit beta-2 complex, local refinement. Determined by electron microscopy at 3.57 Å resolution. Released 24 Jul 2024.

Method: Electron microscopy
Resolution: 3.57 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,586
Mol. weight: 118.76 kDa
Ligands: NAG
Released: 24 Jul 2024

Explore 8YI7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YI7 contains 16 α-helices and 50 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	36-58	23
α-helix	81-84	4
α-helix	118-146	29
α-helix	157-170	14
α-helix	176-179	4
α-helix	188-217	30

Chain B: 6 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	23-27	5	1
β-strand	30-36	7	1
α-helix	41-45	5
β-strand	47-49	3	2
β-strand	59-61	3	3
β-strand	70-71	2	3
β-strand	74-76	3	2
α-helix	82-84	3
β-strand	88-92	5	3
β-strand	95-100	6	3
β-strand	101-108	8	1
β-strand	111-112	2	1
β-strand	117	1	4
β-strand	130-133	4	4
β-strand	139-146	8	4
β-strand	152-153	2	1
β-strand	156-160	5	5
β-strand	168	1	6
β-strand	174-178	5	4
β-strand	187-194	8	4
β-strand	195	1	6
β-strand	208-212	5	5
β-strand	215-216	2	1
β-strand	219-220	2	1
β-strand	223-227	5	5
α-helix	229-232	4
β-strand	233	1	4
α-helix	235-238	4
β-strand	239-245	7	7
α-helix	246	1
β-strand	251-257	7	7
β-strand	271-276	6	8
β-strand	289-291	3	8
β-strand	295-299	5	7
β-strand	305-312	8	8
α-helix	318-322	5
β-strand	323-326	4	8

Chain C: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	31-34	4	9
β-strand	40-41	2	10
β-strand	47	1	11
β-strand	50-53	4	9
β-strand	67-72	6	10
β-strand	76-80	5	10
β-strand	85-86	2	9
β-strand	89	1	11
α-helix	92-93	2
β-strand	95-104	10	10
α-helix	109-110	2
β-strand	111-120	10	10

Chain D: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	12
α-helix	33-34	2
β-strand	47-56	10	13
β-strand	59-66	8	13
β-strand	75-81	7	12
β-strand	87-88	2	12
β-strand	96-99	4	13
β-strand	111-119	9	12
β-strand	122-125	4	12
α-helix	126-128	3
β-strand	129-131	3	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 subunit alpha	A	protein	207	Homo sapiens	P29459 (AlphaFold model)
Interleukin-12 subunit beta	B	protein	307	Homo sapiens	P29460 (AlphaFold model)
Interleukin-12 receptor subunit beta-2	C	protein	302	Homo sapiens	Q99665 (AlphaFold model)
Interleukin-12 receptor subunit beta-1	D	protein	219	Homo sapiens	P42701 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8YI7_1 Interleukin-12 subunit alpha (chains A)
LSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDK
TSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEF
KTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCIL
LHAFRIRAVTIDRVMSYLNASHHHHHH

Sequence of entity 2 (B), FASTA

>8YI7_2 Interleukin-12 subunit beta (chains B)
AIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKE
FGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFT
CWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPA
AEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDT
WSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSE
WASVPCS

Sequence of entity 3 (C), FASTA

>8YI7_3 Interleukin-12 receptor subunit beta-2 (chains C)
KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGH
SLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVAC
TWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAV
NSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSN
SRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEHHHH
HH

Sequence of entity 4 (D), FASTA

>8YI7_4 Interleukin-12 receptor subunit beta-1 (chains D)
CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSS
GRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPL
GDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMN
VAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Structure and assembly of the human IL-12 signaling complex. Chen, H., Ge, X., Li, C. et al. Structure (2024) 32:1640. DOI 10.1016/j.str.2024.07.010 · PubMed

Other PDB entries of the same protein (UniProt P29459 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F45 2.8 Å, Human interleukin-12
3HMX 3.0 Å, Crystal structure of ustekinumab FAB/IL-12 complex
8XRP 3.75 Å, The Cryo-EM structure of IL-12, receptor subunit beta-1 and receptor subunit beta-2…

Browse structure collections

About this viewer

MolViewer shows 8YI7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.