8XSO: DNA-directed RNA polymerase II subunit RPB1

RNA polymerase II elongation complex transcribing genomic DNA extracted from human nuclei. Determined by electron microscopy at 2.7 Å resolution. Released 7 May 2025.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 15
Atoms: 32,521
Mol. weight: 546.38 kDa
Ligands: MG, ZN
Released: 7 May 2025

Explore 8XSO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XSO contains 185 α-helices and 225 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 73 helices, 73 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15-16	2	1
β-strand	20-22	3	2
β-strand	25	1	3
α-helix	26-27	2
α-helix	28-34	7
β-strand	43	1	4
β-strand	47	1	5
β-strand	52	1	5
α-helix	53	1
β-strand	56	1	4
β-strand	86-95	10	6
α-helix	100-109	10
β-strand	110	1	7
β-strand	117	1	7
α-helix	124-132	9
α-helix	137-148	12
β-strand	153	1	8
β-strand	187	1	8
β-strand	190-194	5	9
β-strand	197-201	5	9
β-strand	213-215	3	9
α-helix	218-226	9
α-helix	230-236	7
α-helix	245-248	4
β-strand	249-255	7	6
β-strand	264-266	3	10
β-strand	270-272	3	10
α-helix	275-296	22
α-helix	300-318	19
β-strand	329	1	11
α-helix	334	1
β-strand	335	1	11
α-helix	336	1
α-helix	339-344	6
α-helix	349	1
α-helix	350-355	6
β-strand	357-358	2	12
β-strand	362-369	8	13
β-strand	377-381	5	13
α-helix	382-387	6
β-strand	389-393	5	14
α-helix	399-408	10
β-strand	416-420	5	14
β-strand	426-428	3	14
β-strand	445-449	5	14
α-helix	450	1
β-strand	455-459	5	13
α-helix	466-468	3
β-strand	469-477	9	13
β-strand	482-484	3	13
α-helix	486-488	3
α-helix	489-492	4
β-strand	500-504	5	13
α-helix	509-518	10
β-strand	520	1	13
α-helix	521-524	4
β-strand	526-527	2	15
β-strand	532-533	2	15
α-helix	540-549	10
β-strand	554-555	2	16
α-helix	557-565	9
α-helix	574	1
β-strand	575	1	17
α-helix	576-577	2
β-strand	579	1	18
β-strand	585	1	18
β-strand	586-587	2	16
α-helix	588-595	8
β-strand	602-605	4	19
β-strand	627-630	4	19
β-strand	635-637	3	19
α-helix	642-645	4
α-helix	652-660	9
α-helix	662-683	22
β-strand	686	1	20
α-helix	696-721	26
α-helix	725-728	4
α-helix	733-758	26
α-helix	765-772	8
α-helix	778-785	8
β-strand	789-790	2	21
β-strand	792-793	2	22
β-strand	796-797	2	22
α-helix	811	1
β-strand	822-823	2	21
α-helix	833-868	36
β-strand	872-873	2	23
β-strand	879-880	2	23
β-strand	886-888	3	23
α-helix	891-893	3
β-strand	896	1	24
β-strand	902-905	4	25
α-helix	913-920	8
α-helix	928-933	6
β-strand	934	1	26
α-helix	936-944	9
α-helix	947-969	23
α-helix	971-973	3
β-strand	976-979	4	25
α-helix	983-993	11
β-strand	1002	1	26
α-helix	1006-1018	13
α-helix	1028-1048	21
α-helix	1051-1053	3
α-helix	1054-1058	5
α-helix	1062-1078	17
β-strand	1080	1	24
α-helix	1081-1082	2
α-helix	1087-1100	14
α-helix	1121-1129	9
β-strand	1138-1141	4	27
β-strand	1143	1	28
α-helix	1146-1149	4
α-helix	1151-1161	11
β-strand	1164	1	29
α-helix	1166-1169	4
β-strand	1170-1177	8	30
α-helix	1189-1197	9
β-strand	1210-1216	7	30
α-helix	1218-1223	6
α-helix	1228-1239	12
β-strand	1243-1247	5	30
β-strand	1256-1261	6	30
α-helix	1263-1266	4
α-helix	1281-1295	15
β-strand	1299	1	29
β-strand	1306-1310	5	27
β-strand	1319-1322	4	31
β-strand	1328-1331	4	31
β-strand	1335-1339	5	27
α-helix	1343-1348	6
β-strand	1352	1	28
β-strand	1358-1359	2	27
α-helix	1362-1369	8
α-helix	1371-1387	17
α-helix	1395-1406	12
α-helix	1416-1420	5
α-helix	1426-1430	5
α-helix	1435-1445	11
β-strand	1448-1449	2	2
α-helix	1454-1459	6
α-helix	1467-1469	3
β-strand	1472-1475	4	32
α-helix	1479-1482	4
β-strand	1485	1	33

Chain B: 54 helices, 76 β-strands

Element	Residues	Length	Sheet
α-helix	22-36	15
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
α-helix	63-64	2
β-strand	65-67	3	34
β-strand	83-93	11	34
β-strand	97	1	35
β-strand	107	1	35
α-helix	108-109	2
α-helix	110-115	6
β-strand	121-133	13	34
β-strand	139-153	15	34
α-helix	168-173	6
β-strand	185-187	3	36
β-strand	190-193	4	36
α-helix	194-195	2
β-strand	196-200	5	37
β-strand	206-208	3	38
β-strand	215-222	8	38
β-strand	234-240	7	38
α-helix	247-252	6
β-strand	256-259	4	38
β-strand	267-268	2	38
α-helix	269-275	7
α-helix	281-288	8
α-helix	295-307	13
α-helix	314-323	10
α-helix	332-345	14
α-helix	355-357	3
α-helix	358-377	20
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	37
α-helix	396-423	28
α-helix	437-450	14
β-strand	453	1	39
β-strand	463	1	39
β-strand	468-469	2	36
α-helix	470-471	2
α-helix	475-482	8
β-strand	484-486	3	37
α-helix	497-499	3
α-helix	503-505	3
β-strand	509	1	40
β-strand	523-525	3	37
β-strand	526	1	40
α-helix	527	1
β-strand	531-532	2	41
α-helix	539-547	9
α-helix	550	1
β-strand	551-552	2	42
β-strand	565-569	5	42
β-strand	572-577	6	42
α-helix	580-593	14
β-strand	602-606	5	42
β-strand	611-615	5	42
β-strand	621-627	7	41
β-strand	628-629	2	43
β-strand	632-633	2	43
α-helix	637-644	8
α-helix	653-658	6
β-strand	662-666	5	41
α-helix	670-672	3
β-strand	675-676	2	41
α-helix	679-682	4
β-strand	695-696	2	41
α-helix	700-703	4
α-helix	707-710	4
α-helix	714-716	3
α-helix	719-728	10
α-helix	729-731	3
β-strand	732	1	44
β-strand	748-751	4	45
β-strand	755	1	46
β-strand	759-760	2	47
β-strand	776-782	7	48
β-strand	783	1	20
β-strand	794-797	4	48
α-helix	798-802	5
β-strand	808-817	10	45
β-strand	820	1	49
β-strand	826	1	49
β-strand	827-829	3	50
β-strand	853	1	51
α-helix	854-855	2
β-strand	859-860	2	45
β-strand	865-867	3	51
β-strand	869-872	4	50
β-strand	889-891	3	50
β-strand	894-895	2	51
α-helix	896-897	2
β-strand	902-911	10	45
β-strand	917-927	11	45
β-strand	934-937	4	48
β-strand	942-949	8	48
β-strand	956	1	52
β-strand	965-967	3	48
α-helix	971-975	5
α-helix	978-993	16
β-strand	997-998	2	47
α-helix	1008-1016	9
β-strand	1025-1026	2	48
β-strand	1029	1	52
α-helix	1035	1
β-strand	1036	1	52
α-helix	1037	1
α-helix	1040	1
β-strand	1041-1050	10	48
β-strand	1051	1	44
α-helix	1055-1057	3
β-strand	1060-1062	3	13
β-strand	1067	1	53
β-strand	1074	1	53
α-helix	1075	1
α-helix	1082-1084	3
β-strand	1085-1086	2	12
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1115-1119	5	1
β-strand	1125	1	1
β-strand	1127-1128	2	54
β-strand	1135-1136	2	54
β-strand	1137	1	55
β-strand	1142	1	55
β-strand	1146-1150	5	1
α-helix	1153-1163	11
β-strand	1167	1	3
β-strand	1170-1172	3	2

Chain C: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	56
β-strand	18-24	7	56
α-helix	28-40	13
β-strand	44-55	12	57
α-helix	61-69	9
β-strand	73	1	58
α-helix	83-84	2
α-helix	85-87	3
β-strand	99-106	8	57
α-helix	112	1
β-strand	113-116	4	59
α-helix	117-119	3
β-strand	121-122	2	57
α-helix	125-127	3
β-strand	129	1	58
α-helix	147-148	2
β-strand	149-153	5	59
β-strand	158-168	11	57
α-helix	174-176	3
β-strand	179-186	8	56
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	228-235	8	56
α-helix	241-270	30

Chain D: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	60
α-helix	17-19	3
β-strand	21	1	60
α-helix	26-28	3
α-helix	29	1
β-strand	30	1	32
α-helix	31	1
α-helix	34-49	16
α-helix	54-58	5
α-helix	59-71	13
α-helix	77-89	13
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-137	14

Chain E: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	3-23	21
β-strand	26	1	61
α-helix	30-33	4
α-helix	37-44	8
α-helix	56-58	3
β-strand	60-61	2	62
β-strand	64	1	61
β-strand	73-75	3	62
β-strand	81-82	2	63
α-helix	84-96	13
β-strand	101-106	6	62
β-strand	109-110	2	63
α-helix	112-120	9
β-strand	126-131	6	62
α-helix	139-141	3
β-strand	147-150	4	64
α-helix	151-152	2
α-helix	153-163	11
α-helix	167-169	3
β-strand	172-173	2	64
α-helix	178-183	6
β-strand	190-195	6	64
β-strand	203-209	7	64

Chain F: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	56-57	2	65
α-helix	58	1
α-helix	59-74	16
β-strand	79	1	33
α-helix	82-83	2
α-helix	89-98	10
β-strand	104-109	6	32
α-helix	110	1
β-strand	115-119	5	32
β-strand	124-125	2	65

Chain G: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	32
α-helix	14	1
α-helix	15-17	3
α-helix	22-34	13
β-strand	38-39	2	32
β-strand	43-54	12	32
β-strand	57-59	3	32
α-helix	60	1
α-helix	65	1
β-strand	66-77	12	32
β-strand	84-93	10	66
β-strand	96-101	6	66
β-strand	104-109	6	66
β-strand	117-120	4	67
β-strand	127-130	4	67
β-strand	136-138	3	67
β-strand	142-153	12	66
β-strand	156-162	7	66
β-strand	169	1	66

Chain H: 0 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	4-14	11	18
β-strand	25-32	8	18
β-strand	38-44	7	18
β-strand	55-61	7	18
β-strand	74	1	17
β-strand	90-101	12	18
β-strand	111-118	8	18
β-strand	121-128	8	18
β-strand	140-148	9	18

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase II subunit RPB1	A	protein	1970	Homo sapiens	P24928 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB2	B	protein	1174	Homo sapiens	P30876 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	292	Homo sapiens	P19387 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB4	D	protein	142	Homo sapiens	O15514 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III subunit RPABC1	E	protein	210	Homo sapiens	P19388
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F	protein	127	Homo sapiens	P61218
DNA-directed RNA polymerase II subunit RPB7	G	protein	172	Homo sapiens	P62487
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Homo sapiens	P52434
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Homo sapiens	P36954
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Homo sapiens	P62875
DNA-directed RNA polymerase II subunit RPB11-a	K	protein	117	Homo sapiens	P52435
DNA-directed RNA polymerases I, II, and III subunit RPABC4	L	protein	58	Homo sapiens	P53803

3 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>8XSO_1 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Sequence of entity 2 (B), FASTA

>8XSO_2 DNA-directed RNA polymerase II subunit RPB2 (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 3 (C), FASTA

>8XSO_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MHHHHHHDYKDDDDKGHMPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVP
IIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVEFTL
DVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRA
YAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPN
GKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 4 (D), FASTA

>8XSO_4 DNA-directed RNA polymerase II subunit RPB4 (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY

Sequence of entity 5 (E), FASTA

>8XSO_5 DNA-directed RNA polymerases I, II, and III subunit RPABC1 (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 6 (F), FASTA

>8XSO_6 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIITD

Sequence of entity 7 (G), FASTA

>8XSO_7 DNA-directed RNA polymerase II subunit RPB7 (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Sequence of entity 8 (H), FASTA

>8XSO_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 9 (I), FASTA

>8XSO_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 10 (J), FASTA

>8XSO_10 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 11 (K), FASTA

>8XSO_11 DNA-directed RNA polymerase II subunit RPB11-a (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 12 (L), FASTA

>8XSO_12 DNA-directed RNA polymerases I, II, and III subunit RPABC4 (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ZN	Zinc ion	Zn	8

Primary citation

Multiple structures of RNA polymerase II isolated from human nuclei by ChIP-CryoEM analysis. Kujirai, T., Kato, J., Yamamoto, K. et al. Nat Commun (2025) 16:4724-4724. DOI 10.1038/s41467-025-59580-x · PubMed

Other PDB entries of the same protein (UniProt P24928 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G0R 1.25 Å, Crystal Structure of the first bromodomain of human BRD4 in complex with an acetylated…
7Z1K 1.55 Å, Crystal structure of the SPOC domain of human SHARP (SPEN) in complex with RNA…
3D9N 1.6 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
6XKB 1.6 Å, Crystal structure of SR-related and CTD-associated factor 4(SCAF4-CID)with peptide…
6IC9 1.75 Å, Crystal structure of the SPOC domain of human PHF3 in complex with RNA polymerase II CTD…
3D9M 1.75 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
2GHT 1.8 Å, CTD-specific phosphatase Scp1 in complex with peptide from C-terminal domain of RNA…
4JXT 1.9 Å, CID of human RPRD1A in complex with a phosphorylated peptide from RPB1-CTD
6IC8 1.93 Å, Crystal structure of the SPOC domain of human PHF3 in complex with RNA polymerase II CTD…
3D9O 2.0 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
2GHQ 2.05 Å, CTD-specific phosphatase Scp1 in complex with peptide C-terminal domain of RNA…
3D9P 2.1 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…

Browse structure collections

About this viewer

MolViewer shows 8XSO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.