8XWF: CXCR2

Structure of CXCR2 bound to CXCL3 (Ligand-receptor focused map). Determined by electron microscopy at 3.65 Å resolution. Released 15 Jan 2025.

Method: Electron microscopy
Resolution: 3.65 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,090
Mol. weight: 62.45 kDa
Released: 15 Jan 2025

Explore 8XWF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XWF contains 18 α-helices and 11 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
β-strand	23-29	7	1
β-strand	39-44	6	1
β-strand	49-52	4	1
α-helix	57-66	10

Chain E: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
β-strand	23-29	7	1
β-strand	32	1	2
β-strand	35	1	2
β-strand	39-44	6	1
β-strand	49-52	4	1
α-helix	57-68	12

Chain R: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	45-75	31
α-helix	82-110	29
α-helix	117-148	32
α-helix	155-159	5
α-helix	162-176	15
α-helix	178-182	5
β-strand	184-187	4	3
β-strand	195-198	4	3
α-helix	204-211	8
α-helix	213-216	4
α-helix	217-221	5
α-helix	222-239	18
α-helix	246-278	33
α-helix	286-303	18
α-helix	305-310	6
α-helix	311-316	6
α-helix	319-328	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-X-C motif chemokine 3	D, E	protein	73	Homo sapiens	P19876 (AlphaFold model)
C-X-C chemokine receptor type 2	R	protein	416	Homo sapiens	P25025 (AlphaFold model)

Sequence of entity 1 (D, E), FASTA

>8XWF_1 C-X-C motif chemokine 3 (chains D, E)
ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQ
KIIEKILNKGSTN

Sequence of entity 2 (R), FASTA

>8XWF_2 C-X-C chemokine receptor type 2 (chains R)
MGKTIIALSYIFCLVFADYKDDDDAANFTPVNGSSGNQSVRLVTSSSLEVLFQGPGSEDF
NMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLL
GNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSL
LKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFR
RTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMG
QKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILGI
LHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL

Primary citation

Molecular basis of promiscuous chemokine binding and structural mimicry at the C-X-C chemokine receptor, CXCR2. Saha, S., Sano, F.K., Sharma, S. et al. Mol Cell (2025) 85:976-988.e9. DOI 10.1016/j.molcel.2025.01.024 · PubMed

Other PDB entries of the same protein (UniProt P19876 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XX3 3.38 Å, Structure of CXCR2 bound to CXCL3 (CXCR2-CXCL3-Go Full map)

Browse structure collections

About this viewer

MolViewer shows 8XWF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.