8XWM: CXCR2

Structure of CXCR2 bound to CXCL6 (Ligand-receptor focused map). Determined by electron microscopy at 3.71 Å resolution. Released 15 Jan 2025.

Method: Electron microscopy
Resolution: 3.71 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,722
Mol. weight: 55.03 kDa
Released: 15 Jan 2025

Explore 8XWM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XWM contains 15 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	1
α-helix	23-25	3
β-strand	26-32	7	1
β-strand	42-47	6	1
β-strand	52-55	4	1
α-helix	60-68	9

Chain R: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	40-42	3
α-helix	45-75	31
α-helix	82-110	29
α-helix	116-148	33
α-helix	154-159	6
α-helix	162-182	21
β-strand	184-187	4	2
β-strand	195-198	4	2
α-helix	204-212	9
α-helix	221-239	19
α-helix	246-278	33
α-helix	286-303	18
α-helix	306-310	5
α-helix	311-316	6
α-helix	319-328	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-X-C motif chemokine 6	D	protein	77	Homo sapiens	P80162 (AlphaFold model)
C-X-C chemokine receptor type 2	R	protein	416	Homo sapiens	P25025 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>8XWM_1 C-X-C motif chemokine 6 (chains D)
GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAP
FLKKVIQKILDSGNKKN

Sequence of entity 2 (R), FASTA

>8XWM_2 C-X-C chemokine receptor type 2 (chains R)
MGKTIIALSYIFCLVFADYKDDDDAANFTPVNGSSGNQSVRLVTSSSLEVLFQGPGSEDF
NMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLL
GNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSL
LKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFR
RTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMG
QKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILGI
LHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL

Primary citation

Molecular basis of promiscuous chemokine binding and structural mimicry at the C-X-C chemokine receptor, CXCR2. Saha, S., Sano, F.K., Sharma, S. et al. Mol Cell (2025) 85:976-988.e9. DOI 10.1016/j.molcel.2025.01.024 · PubMed

Other PDB entries of the same protein (UniProt P80162 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XXX 3.17 Å, Structure of CXCR2 bound to CXCL6 (Composite map)

Browse structure collections

About this viewer

MolViewer shows 8XWM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.