8XWY: Interleukin-27

Structure of Interleukin-27. Determined by X-ray diffraction at 3.4 Å resolution. Released 22 Jan 2025.

Method: X-ray diffraction
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,528
Mol. weight: 96.34 kDa
Ligands: NAG
Released: 22 Jan 2025

Explore 8XWY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XWY contains 23 α-helices and 33 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	44-72	29
α-helix	88-89	2
β-strand	92-93	2	1
α-helix	94-99	6
α-helix	102-112	11
α-helix	116-126	11
α-helix	131-157	27
α-helix	197-225	29

Chain B: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	34-36	3	2
β-strand	43-47	5	2
β-strand	65-68	4	3
β-strand	77-78	2	3
β-strand	88-92	5	2
α-helix	94	1
β-strand	95-96	2	1
α-helix	101	1
β-strand	102-105	4	3
β-strand	118-121	4	3
α-helix	129-132	4
β-strand	133-139	7	4
β-strand	144-150	7	4
β-strand	163-171	9	5
β-strand	178-183	6	5
β-strand	187-191	5	4
β-strand	198-207	10	5
α-helix	213-220	8
β-strand	221-224	4	5

Chain C: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	34-36	3	6
β-strand	43-47	5	6
β-strand	65-68	4	7
β-strand	77-78	2	7
α-helix	79	1
β-strand	80	1	6
β-strand	88-92	5	6
α-helix	94	1
β-strand	95-96	2	8
α-helix	101	1
β-strand	102-105	4	7
β-strand	120-121	2	7
α-helix	129-132	4
β-strand	133-139	7	9
β-strand	144-150	7	9
β-strand	163-170	8	10
β-strand	178-183	6	10
β-strand	187-191	5	9
β-strand	198-207	10	10
α-helix	213-220	8
β-strand	221-224	4	10

Chain D: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	40-72	33
α-helix	78-80	3
β-strand	92-93	2	8
α-helix	94-97	4
α-helix	102-113	12
α-helix	116-123	8
α-helix	131-157	27
α-helix	197-225	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-27 subunit alpha	A, D	protein	215	Homo sapiens	Q8NEV9 (AlphaFold model)
Interleukin-27 subunit beta	B, C	protein	209	Homo sapiens	Q14213 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>8XWY_1 Interleukin-27 subunit alpha (chains A, D)
FPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLP
DVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQ
RHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLH
SLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP

Sequence of entity 2 (B, C), FASTA

>8XWY_2 Interleukin-27 subunit beta (chains B, C)
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCL
QQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPL
AERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYY
VQVAAQDLTDYGELSDWSLPATATMSLGK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure of IL-27 indicates a much broader promiscuous pairing of the IL-6/IL-12 family. Feng, Y., Dong, X.C. To be published.

Other PDB entries of the same protein (UniProt Q8NEV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZXK 2.2 Å, Human IL-27 in complex with neutralizing SRF388 FAb fragment
7U7N 3.47 Å, IL-27 quaternary receptor signaling complex
8D85 3.81 Å, Cryo-EM structure of human IL-27 signaling complex: model containing the interaction…

Browse structure collections

About this viewer

MolViewer shows 8XWY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.