7U7N: IL-27 quaternary receptor signaling complex

IL-27 quaternary receptor signaling complex. Determined by electron microscopy at 3.47 Å resolution. Released 25 May 2022.

Method: Electron microscopy
Resolution: 3.47 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,284
Mol. weight: 107.16 kDa
Ligands: NAG
Released: 25 May 2022

Explore 7U7N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7U7N contains 30 α-helices and 66 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	40-43	4	1
β-strand	50-53	4	1
β-strand	65-70	6	2
β-strand	79-82	4	2
β-strand	89-92	4	1
α-helix	94-96	3
β-strand	102-109	8	2
β-strand	112-113	2	2
β-strand	118-121	4	2
β-strand	126	1	1
β-strand	132-139	8	3
β-strand	146-152	7	3
β-strand	163-170	8	4
β-strand	177-178	2	4
β-strand	183-184	2	4
α-helix	189-190	2
β-strand	191-194	4	3
α-helix	196-197	2
β-strand	201-209	9	4
α-helix	219-223	5
β-strand	224-227	4	4

Chain B: 10 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	29-32	4	5
β-strand	37-39	3	6
β-strand	44-50	7	5
α-helix	52-58	7
α-helix	62-64	3
β-strand	65-69	5	6
β-strand	72-73	2	6
α-helix	76-78	3
β-strand	79-81	3	5
β-strand	86-91	6	5
β-strand	98-107	10	6
β-strand	111-123	13	6
α-helix	125-129	5
β-strand	130	1	7
β-strand	135	1	8
β-strand	136	1	9
β-strand	143-145	3	8
β-strand	147	1	7
β-strand	157-163	7	10
β-strand	168	1	10
β-strand	172-173	2	10
α-helix	174-175	2
β-strand	181-183	3	8
β-strand	194-202	9	10
β-strand	205-208	4	10
β-strand	212-214	3	10
α-helix	216-219	4
β-strand	220	1	9
α-helix	222-225	4
β-strand	226-232	7	11
β-strand	240-245	6	11
α-helix	248-251	4
β-strand	255-263	9	12
β-strand	270-271	2	12
α-helix	274-277	4
β-strand	283-286	4	11
β-strand	294-303	10	12
α-helix	310-316	7
β-strand	317-320	4	12

Chain C: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	32-36	5	13
β-strand	37	1	14
β-strand	38-39	2	13
β-strand	43-49	7	13
β-strand	61-68	8	15
β-strand	77-78	2	15
α-helix	79	1
β-strand	80-81	2	13
β-strand	88-92	5	13
β-strand	96	1	16
α-helix	101	1
β-strand	102-110	9	15
β-strand	113-121	9	15
α-helix	123-125	3
β-strand	127	1	14
α-helix	129-132	4
β-strand	133-141	9	17
β-strand	144-150	7	17
β-strand	163-171	9	18
α-helix	175-177	3
β-strand	178-183	6	18
β-strand	187-191	5	17
β-strand	198-207	10	18
α-helix	214-217	4
β-strand	221-224	4	18

Chain D: 10 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	37-39	3
α-helix	44-72	29
α-helix	78-80	3
α-helix	82-84	3
β-strand	92	1	16
α-helix	94-99	6
α-helix	102-113	12
α-helix	116-124	9
α-helix	131-158	28
α-helix	166-178	13
α-helix	197-225	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-27 receptor subunit alpha	A	protein	196	Homo sapiens	Q6UWB1 (AlphaFold model)
Interleukin-6 receptor subunit beta	B	protein	299	Homo sapiens	P40189 (AlphaFold model)
Interleukin-27 subunit beta	C	protein	208	Homo sapiens	Q14213 (AlphaFold model)
Interleukin-27 subunit alpha	D	protein	215	Homo sapiens	Q8NEV9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7U7N_1 Interleukin-27 receptor subunit alpha (chains A)
AGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPRE
QLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFSEDDPLEATVHWAPPT
WPSHKVLICQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATGYKVYGRCRMEKEED
LWGEWSPILSFQTPPS

Sequence of entity 2 (B), FASTA

>7U7N_2 Interleukin-6 receptor subunit beta (chains B)
ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTII
NRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKM
RCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAEN
ALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYR
TKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGIT

Sequence of entity 3 (C), FASTA

>7U7N_3 Interleukin-27 subunit beta (chains C)
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCL
QQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPL
AERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYY
VQVAAQDLTDYGELSDWSLPATATMSLG

Sequence of entity 4 (D), FASTA

>7U7N_4 Interleukin-27 subunit alpha (chains D)
FPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLP
DVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQ
RHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLH
SLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Structure of the IL-27 quaternary receptor signaling complex. Caveney, N.A., Glassman, C.R., Jude, K.M. et al. Elife (2022) 11. DOI 10.7554/eLife.78463 · PubMed

Other PDB entries of the same protein (UniProt Q6UWB1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7T5M 1.67 Å, Structure of HLA-A*02:01-FLPTPEELGLLGPPRPQVLA complex
8D85 3.81 Å, Cryo-EM structure of human IL-27 signaling complex: model containing the interaction…

Browse structure collections

About this viewer

MolViewer shows 7U7N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.